close all open/close all

CDS information : Virg_00150


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction45,203 / 44,295 / - [in whole cluster]
16,827 / 15,919 / - [in contig]
Locationcomplement(44295..45203) [in whole cluster]
complement(15919..16827) [in contig]
TypeCDS
Length909 bp (302 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative phosphopantetheinyl transferase
Product (GenBank)4-phosphopantetheinyl transferase
Gene
Gene (GenBank)virK
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17350183] Characterization of biosynthetic gene cluster for the production of virginiamycin M, a streptogramin type A antibiotic, in Streptomyces virginiae. (Gene. , 2007)
Related Reference
ACC
Q9RFL1
NITE
Myxo_00010
PmId
[10601310] New lessons for combinatorial biosynthesis from myxobacteria. The myxothiazol biosynthetic gene cluster of Stigmatella aurantiaca DW4/3-1. (J Biol Chem. , 1999)
[11134965] The mtaA gene of the myxothiazol biosynthetic gene cluster from Stigmatella aurantiaca DW4/3-1 encodes a phosphopantetheinyl transferase that activates polyketide synthases and polypeptide synthetases. (J Biochem. , 2001)

close this sectionSequence

selected fasta
>putative phosphopantetheinyl transferase [4-phosphopantetheinyl transferase]
MSARAAAGARRPADGEVRLWVCANDDLGPGTATALAGHWLDEHEQATADRFIFERDRRQY
LVAHVLVRRLLSLETGVPEALIELRRSERGRPSVRPPEGGWPAAQGPLDFNLSHARGYNA
IAVGRGRRVGVDVERLDRVSSRALDGIAESFTPGERVQLARTPAEVYDRTVLRLWTLKEA
YAKARGLGLGLPFDSFGFVLSDNGGVAAFEPPADDPSGTWWLLELEPEPGVLVSLAVEDG
ATPMTALRLHTGFPWRPSALRASIHPGNPVPLLAPGTLSAALPLAGAAPHRARPTELQRS
VA
selected fasta
>putative phosphopantetheinyl transferase [4-phosphopantetheinyl transferase]
ATGAGCGCGCGGGCGGCCGCAGGCGCACGGCGGCCCGCCGACGGCGAGGTCAGGCTCTGG
GTGTGCGCCAACGACGACCTCGGGCCGGGCACCGCCACCGCCCTGGCCGGCCACTGGCTG
GACGAGCACGAACAGGCGACCGCGGACCGGTTCATCTTCGAGCGGGACCGCCGCCAGTAC
CTCGTGGCACACGTCCTCGTGCGGCGCCTGCTCTCGCTGGAGACCGGTGTCCCCGAGGCG
CTGATCGAGCTGCGCAGGTCCGAGCGTGGCCGGCCCTCCGTACGGCCGCCCGAGGGCGGC
TGGCCCGCCGCACAGGGCCCGCTGGACTTCAACCTCTCGCACGCCCGCGGATACAACGCG
ATCGCGGTCGGCCGGGGACGCCGGGTCGGGGTCGACGTCGAACGGCTCGACCGGGTGAGC
AGCCGCGCACTGGACGGGATCGCCGAGAGCTTCACCCCCGGCGAGCGCGTCCAGCTGGCC
CGGACACCCGCTGAGGTGTACGACCGAACGGTGCTGCGCCTGTGGACGCTCAAGGAGGCC
TACGCCAAGGCGCGCGGACTCGGCCTCGGACTGCCCTTCGACTCGTTCGGCTTCGTGCTG
TCCGACAACGGCGGGGTGGCCGCGTTCGAACCGCCGGCCGACGACCCGTCGGGAACCTGG
TGGTTGCTCGAACTCGAACCCGAGCCCGGGGTGCTGGTCTCCCTCGCGGTCGAGGACGGG
GCCACCCCGATGACCGCGCTCAGGCTGCACACGGGCTTCCCCTGGCGGCCCTCCGCCCTG
CGCGCGAGCATCCACCCCGGGAACCCCGTCCCGCTGCTCGCCCCCGGGACCCTCTCCGCC
GCGCTCCCCCTCGCCGGGGCCGCGCCCCACCGAGCGCGCCCCACCGAACTCCAGAGGAGC
GTCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008278 4'-phosphopantetheinyl transferase (Domain)
 [17-133]  9.59999914716171e-24 SSF56214 [127-259]  1.70000295590054e-24 SSF56214
SSF56214   4-PPT_transf
 [128-203]  4.40000000000001e-13 PF01648
PF01648   ACPS
 [128-237]  1.3e-12 G3DSA:3.90.470.20
G3DSA:3.90.470.20   G3DSA:3.90.470.20
SignalP
 [1-5]  0.385 Signal
Bacteria, Gram-positive   
TMHMM No significant hit