close all open/close all

CDS information : Virg_00160


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction46,003 / 45,200 / - [in whole cluster]
17,627 / 16,824 / - [in contig]
Locationcomplement(45200..46003) [in whole cluster]
complement(16824..17627) [in contig]
TypeCDS
Length804 bp (267 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)thioesterase
Gene
Gene (GenBank)virJ
EC number
Keyword
  • virginiamycin M
  • type II thioesterase
Note
Note (GenBank)
Reference
ACC
PmId
[17350183] Characterization of biosynthetic gene cluster for the production of virginiamycin M, a streptogramin type A antibiotic, in Streptomyces virginiae. (Gene. , 2007)
Related Reference
ACC
Q9LAS9
PmId
[12055297] Type II thioesterase from Streptomyces coelicolor A3(2). (Microbiology. , 2002)

close this sectionSequence

selected fasta
>putative type II thioesterase [thioesterase]
MTSNTLRFRPPAGAGHCPRPVPGAALRLFLFHHAGGSHLVYRDWITHFPADWEIHLLDAP
GRGRLTDVPACADAERLVDFFHDEIVLAMDRPFAFFGHSMGGLAAYELTNRLAAEGLPLP
AWLGLSARGAPRQPLPTDNRHRMPDAELRRHLARMGGTPPEVLEDPDIWQLFAPMIRNDL
RLVETWSPRPHTPPLSVPLSVFGGADDVVVSPERLAAWEQYAQRFLGLHLFDGDHFYFRS
RPAEMVRLITEQVRTATAGRPATGAAR
selected fasta
>putative type II thioesterase [thioesterase]
ATGACGAGCAACACCTTGAGGTTCCGCCCGCCGGCCGGAGCGGGCCACTGCCCCCGCCCG
GTCCCGGGAGCGGCCCTGCGCCTGTTCCTGTTCCACCACGCCGGCGGCTCCCACCTGGTG
TACCGCGACTGGATCACGCACTTCCCGGCCGACTGGGAGATCCACCTGCTGGACGCCCCC
GGCCGAGGCCGACTGACCGACGTGCCGGCCTGCGCCGACGCCGAACGGCTGGTGGACTTC
TTCCACGACGAGATCGTGCTCGCGATGGACCGCCCGTTCGCCTTCTTCGGCCACAGCATG
GGCGGCCTGGCCGCCTACGAGCTCACCAACCGGCTGGCCGCCGAGGGGCTGCCGCTCCCC
GCATGGCTCGGCCTGTCGGCCCGCGGCGCGCCGCGGCAGCCGCTCCCGACCGACAACCGC
CACCGCATGCCCGACGCCGAACTCCGCCGGCACCTGGCACGGATGGGCGGCACCCCGCCC
GAGGTCCTGGAAGACCCGGACATCTGGCAGCTGTTCGCTCCGATGATCCGCAACGACCTG
CGGCTGGTGGAGACCTGGAGCCCGCGGCCGCACACGCCGCCGCTGTCCGTCCCGCTGTCC
GTCTTCGGCGGCGCCGACGATGTGGTGGTCTCGCCCGAGCGGTTGGCCGCCTGGGAGCAG
TACGCGCAACGGTTCCTCGGCCTCCACCTCTTCGACGGCGATCACTTCTACTTCCGCAGC
CGCCCCGCCGAGATGGTCCGGCTGATCACCGAACAGGTCCGGACCGCGACGGCGGGCCGC
CCGGCGACGGGAGCGGCGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [27-251]  3.40000000000004e-40 PF00975
PF00975   Thioesterase
SignalP
 [1-36]  0.753 Signal
Eukaryota   
 [1-34]  0.323 Signal
Bacteria, Gram-negative   
TMHMM No significant hit