close all open/close all

CDS information : Virg_00170


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction46,923 / 46,036 / - [in whole cluster]
18,547 / 17,660 / - [in contig]
Locationcomplement(46036..46923) [in whole cluster]
complement(17660..18547) [in contig]
TypeCDS
Length888 bp (295 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative trans-acting acyltransferase
Product (GenBank)acyltransferase
Gene
Gene (GenBank)virI
EC number
Keyword
  • virginiamycin M
  • trans AT
Note
Note (GenBank)
Reference
ACC
PmId
[17350183] Characterization of biosynthetic gene cluster for the production of virginiamycin M, a streptogramin type A antibiotic, in Streptomyces virginiae. (Gene. , 2007)
Related Reference
ACC
O34825
PmId
[17234808] The identification of bacillaene, the product of the PksX megacomplex in Bacillus subtilis. (Proc Natl Acad Sci U S A. , 2007)

close this sectionPKS/NRPS Module

M10 malonyl-CoA
not conserved HAFHS(H->G,A->P)
AT4..283

close this sectionSequence

selected fasta
>putative trans-acting acyltransferase [acyltransferase]
MTRIFMFPGQGAQRVGMGRTLLDRFPDLEREASDTLGYSLRRLCLEDPEGRLGNTRYTQP
AMFAVNALAHRAAVEDGARPDIAIGHSLGEYNALEAAGVFGFTDGLRLVAARAAAMAEVG
GGGMSAVVGLTETKLRFLLLRAGFATLDLANLNTASQTVLAGPLEDLEEAGQVLEDAGAR
MVRRLDVSGPFHSRYMAPAAAALVPLVRSARLRPPAFPVIANRTAQPYRAELAADLLLQQ
IDHPVRWHETVRTLLDEPDAVFTEIGESTVLTSMVRQIKRDAEPARAARPRQAVA
selected fasta
>putative trans-acting acyltransferase [acyltransferase]
ATGACCCGGATCTTTATGTTTCCCGGACAGGGAGCGCAGCGCGTCGGCATGGGCCGGACG
CTTCTCGACCGCTTCCCCGACCTCGAACGCGAGGCCAGCGACACGCTCGGCTACAGCCTG
CGCCGGCTGTGCCTGGAGGACCCCGAGGGCAGGCTCGGCAACACCCGCTACACCCAGCCC
GCGATGTTCGCCGTGAACGCCCTCGCCCACCGCGCGGCCGTCGAGGACGGGGCCCGCCCC
GACATCGCGATCGGTCACAGCCTGGGTGAGTACAACGCCCTGGAAGCCGCCGGGGTCTTC
GGCTTCACCGACGGCCTGCGGCTGGTCGCGGCCCGCGCCGCGGCCATGGCCGAGGTGGGC
GGCGGAGGGATGAGCGCGGTCGTCGGGCTCACCGAGACCAAGCTGCGCTTCCTGCTCCTG
CGCGCCGGATTCGCAACGCTGGACCTCGCCAACCTCAACACCGCGAGCCAGACCGTCCTG
GCCGGGCCGCTGGAGGACCTGGAGGAAGCAGGCCAGGTACTGGAGGACGCCGGCGCGCGC
ATGGTCCGCCGACTGGACGTCAGCGGCCCCTTCCACTCCCGGTACATGGCGCCCGCCGCC
GCCGCGCTCGTCCCGCTGGTCCGGTCCGCCCGGCTCCGGCCACCGGCCTTCCCCGTGATC
GCCAACCGCACCGCGCAGCCGTACCGCGCAGAGCTGGCCGCCGACCTGCTGCTCCAGCAG
ATCGACCACCCCGTGCGCTGGCACGAGACCGTCCGCACCCTGCTCGACGAGCCTGACGCG
GTGTTCACCGAGATCGGCGAGAGCACCGTGCTGACCAGCATGGTCCGGCAGATCAAGCGG
GACGCCGAGCCCGCCCGCGCGGCCCGCCCGCGCCAGGCCGTCGCCTGA
[10] AT4..283
[10] malonyl-CoA not conserved HAFHS(H->G,A->P)189..193
[10] AT10..849
[10] malonyl-CoA not conserved HAFHS(H->G,A->P)565..579

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [4-116]  3.09999999999998e-57 G3DSA:3.40.366.10 [188-282]  3.09999999999998e-57 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR004410 Malonyl CoA-acyl carrier protein transacylase, FabD-type (Family)
 [4-281]  7.30000000000007e-80 TIGR00128
TIGR00128   FabD
IPR014043 Acyl transferase (Domain)
 [4-283]  1.29999999999998e-36 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [1-293]  2.69998997787809e-59 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [120-188]  8.69999350765688e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR024925 Malonyl CoA-acyl carrier protein transacylase (Family)
 [1-295]  8.50003024809048e-65 PIRSF000446
PIRSF000446   Mct
SignalP No significant hit
TMHMM No significant hit