close all open/close all

CDS information : Virg_00180


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction54,721 / 46,952 / - [in whole cluster]
26,345 / 18,576 / - [in contig]
Locationcomplement(46952..54721) [in whole cluster]
complement(18576..26345) [in contig]
TypeCDS
Length7,770 bp (2,589 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.3 PKS/NRPS hybrid
Productnon-ribosomal peptide synthetase/polyketide synthase
Product (GenBank)hybrid non ribosomal peptide synthetase-polyketide synthase
Gene
Gene (GenBank)virH
EC number
Keyword
  • virginiamycin M
Note
Note (GenBank)
Reference
ACC
PmId
[17350183] Characterization of biosynthetic gene cluster for the production of virginiamycin M, a streptogramin type A antibiotic, in Streptomyces virginiae. (Gene. , 2007)

close this sectionPKS/NRPS Module

M8 serine
9
C12..301
C465..759
A937..1342
PCP1473..1540
PCP1565..1632
ks1905..2286
ACP2514..2583

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase/polyketide synthase [hybrid non ribosomal peptide synthetase-polyketide synthase]
MTIQNNAADRYQPFSLTEVQESFYVGRTAGGHAGGTQIHLEFEADHLDPARLRESWNRCV
ADTDMLRAHLLPDARQAVLEQAPEYRFEVRDLTAVGRDELRASLERMRRESAAAIDPHRW
PLFALAAAELPGGRTRVMLTVEELIADGPSVSLLVQDWYARYAFGEEPGVPEISFRDYAL
ATGGRRPSEESLAYWRDKLGAVDFGRPLPLARPDADPAAAADGEHRRMTLHLDREQWDRA
KEAAREARATPSAMLLALNAAAVGTAGSGPLPLVLTTYNRLPLHADVARLVGPFLSTSVF
VAPEAAGTLGELLGEVSGQLWRDLEHGDVSGVRALRERARTEPGRRAVPVPVVFTSLLGS
VTDRRAADPGNWAALVDVDASATRTSGVQLEMCVQERAGQLHVSWDYLPGALDGAEVRAA
FERLGALLRRVAALGPAVWNTGLPATAAPDAGTETAGRASFGTAGRLPLTEVQSAYLVGR
LGTLGGATETRVYQEFLLENHDVDTLEAAWNRLVAHHPMLRAAVHQDGTLEVAPAVPHYR
ITRHDLTGLRPAEGPAADGGSPVERALADTAARLRGGTFPLGSRPMYALEASILPDGTTV
LHVVLDALLADARSFALLFGQLFALHDGDSSVLDEPADPGPYLLGLPAHGQDGSAEAARL
AWREKFAALPAGPPLPDPAPQAARLHRRTDLGSWRRLTERAAAIGVPADMVLLTAYTDEL
RRTFGPEPFTVTVVSWDRPAGLAHADRMVADFTQLAWVVVDDTLPADFAQRARELWGRVR
ADLERGEFRPGLAELRGRVFRSGGRLRLPVVFTRVPEIDPALHPRGVRLRESQSQTAQVA
LDHVPLLVGDDLVGQWDAAEGCLSADRMDTMFEGYARRIRSFVESAGSAGSAGSVESAGS
AGSADELSATMTGLLAETLSRHPDRPAVHWDGRVVDYRELDHRTARLAHQLIASGIRPGD
HVAVHMNRSDDLVVALVGIVRAGAVYVPVDPANPPERVRYLLEDSGARVVVADAALAAVP
AAAGAVVLCQDRDEDRALLASRPVTPPQVEVGPDDPVYTIYTSGTTGKPKGCRNTHRGFV
NRVRWMQDRFPLGADDRVAQKTPYGFDVSAWEFFWPLLAGASIVVARPGGHVDPGYLARL
LREERVTVAHFVPSVLGLFLRDRAASDCASLRYVFASGEALPVATMKRFFQVLPDGAELH
NLYGPTEAAIDVTHWACRPDWDEPTVPIGRPIARTRIHVVDERMARVPDGTPGEIVIGGA
GVALGYHGRPELTAERFVASPFADDPSPRLYRTGDLGQLGPDGEIRYLGRIDGQFKLRGL
RIEPEEVEAALTELPGVSEARVLPVTDPATGEQILAAVCVEADGTLAPSVGQMRRDLARS
LPSYLVPSSFRFVDRLPLTANGKLDRRAATALFGTTPPAAPAAPAPVAPAPVVVPDPAAA
AAPRPPALTGHPAPAIEEDPVYDPRNGRPDEGTAALVGAAVADCLRLEVVDPDADLFDLG
ATSFTMIRLAQEIERLTGVALSVDALISGPTVTALLAAVRAGRAAADRTEPETTGAAVPP
GPQADVAAVADLAAGLLGLAEADPDTDLFDLGATSFTMIRLAQELAERFGADVPVDALIQ
TPTARGIAASLAPASAPQAAAAPRAAASAARTDIRIALDPQAKAAFKEARVAERRLPGSL
ARLPFPDPTPQDRRAFYDASSFREFADGPLPGDRLTELLGTLARGELDGRAKHRYPSAGG
FYPVQVYLYVRPGAVEGVDGGLYYLHPGERALVAIDPQARFGTDVHVFHNRALVDASAFG
VFLVSTPAAIAPAYGERNAGRFSMIEAGHVAQLLLTAGPERGLGMCAVGEMDFGAVRGHF
GLQDDQELLVSLWGGALSGPAVLRRAELVAAERPQESAPVPSGPRPVAVVGFAARLPGAD
DLRGLDAMLAAGDCALGPAPQERWAPLRSNARRAGARVGGYLPDVTAVEVEEFGLADAEV
AAVDPQERLLLTVTRHCLEDAAITPERLSQTGQVGVFVGSMWQDHALHGVAARAEGRTGT
HATRGGLAHRMSHAFGLTGPSLVIDTGCVSGLAAVEAAFRAVADGRCEAAVAAGSNLVLH
PDHLDVLSELGLVAEQEDSCAFTDRASGWLVGEGVGAVLLKPLDRALEDGDPVHAVLRGG
ALLHSGTTRQFGIPDPRRQEQVMRAALADARLTAGDIGYVEAAAAGAALADALEFTALGR
LFGAAGVDGGADVEGASGAGNGARAGLGPVPVGSVKPNTGHLEAASVFAQLGKLIAQFRR
DRLYPTRLTSAANPALAPYRGSVALAGPSADQWRTAPGGTRRALVNGFAGGGSYGSLVVE
EPPAAATAAPADADTAVSEGTEVLVLSADNPENLARWARSLAEELDADPGLDLAAVARTL
REGRRARAVRGAVAADRGRAAGALRTLAERVLRDGTGATVEAARTTADQQALTALWSAGG
ELPVPATSAVPRRRPLPPVPLSVRRVPLPVPAAASARPEKEQQPDGPTGTGPTPFERMAG
IVAQEPGADPDRLAPADDLFAMGVTSRQLLRIAARVADDGGSELPLESLFTAPDLAALAE
LAFPIAVPA
selected fasta
>non-ribosomal peptide synthetase/polyketide synthase [hybrid non ribosomal peptide synthetase-polyketide synthase]
ATGACCATCCAGAACAACGCCGCCGACCGCTACCAGCCCTTCTCCCTCACCGAGGTCCAG
GAGTCCTTCTACGTCGGCCGGACGGCGGGCGGACACGCCGGCGGCACCCAGATCCACCTG
GAGTTCGAGGCGGACCACCTCGACCCGGCGCGGCTGCGGGAGAGCTGGAACCGCTGCGTC
GCCGACACCGACATGCTCCGCGCCCACCTGCTGCCCGACGCCCGCCAGGCCGTCCTGGAG
CAGGCGCCCGAGTACCGGTTCGAGGTCCGCGACCTCACCGCGGTCGGCCGCGACGAGCTG
CGCGCCTCACTGGAGCGGATGCGCCGGGAGTCCGCCGCCGCCATCGACCCGCACCGCTGG
CCGCTGTTCGCCCTCGCCGCCGCCGAACTGCCGGGCGGGCGCACCAGGGTGATGCTCACC
GTCGAGGAGCTGATCGCCGACGGCCCGAGCGTTTCGCTGCTGGTCCAGGACTGGTACGCG
CGCTACGCGTTCGGCGAGGAGCCCGGCGTCCCGGAGATCTCCTTCCGCGACTACGCGCTC
GCCACCGGCGGCCGCCGCCCGTCCGAGGAGTCCCTCGCGTACTGGCGGGACAAGCTCGGG
GCGGTGGACTTCGGCCGGCCGCTGCCGCTCGCCCGCCCGGACGCCGACCCGGCGGCCGCC
GCCGACGGCGAGCACCGGCGCATGACGCTCCACCTGGACCGCGAGCAGTGGGACCGCGCC
AAGGAGGCCGCCCGTGAGGCCCGGGCCACCCCGTCGGCGATGCTGCTTGCGCTGAACGCC
GCTGCCGTCGGCACAGCCGGCAGCGGACCGCTCCCGCTGGTCCTCACCACCTACAACCGC
CTCCCGCTCCACGCCGACGTGGCCCGCCTGGTCGGCCCGTTCCTGTCCACCTCGGTCTTC
GTCGCCCCCGAGGCGGCCGGAACCCTGGGCGAGCTGCTCGGCGAGGTCAGCGGCCAGCTC
TGGCGCGACCTGGAGCACGGCGACGTCAGCGGGGTGCGCGCGCTGCGCGAACGCGCCCGC
ACCGAGCCCGGCCGCCGGGCGGTCCCCGTGCCGGTCGTCTTCACCAGCCTGCTCGGCAGC
GTCACCGACCGGCGCGCCGCCGACCCCGGCAACTGGGCCGCCCTGGTCGACGTCGACGCA
TCCGCCACCCGTACCTCCGGCGTCCAGCTCGAGATGTGCGTCCAGGAGCGTGCCGGGCAG
CTCCACGTGTCCTGGGACTACCTGCCCGGGGCGCTGGACGGCGCCGAGGTGCGGGCCGCC
TTCGAGCGGCTCGGAGCCCTGCTGCGCCGGGTCGCGGCGCTCGGCCCGGCCGTGTGGAAC
ACCGGCCTGCCGGCCACCGCCGCGCCGGACGCCGGTACGGAGACAGCCGGCCGGGCGTCC
TTCGGCACCGCCGGGCGACTGCCGCTGACCGAGGTGCAGTCGGCCTACCTGGTCGGCCGG
CTCGGCACCCTCGGCGGCGCCACGGAGACCCGCGTCTACCAGGAGTTCCTTCTGGAGAAC
CACGATGTGGACACCCTGGAGGCGGCCTGGAACCGGCTGGTCGCCCACCACCCGATGCTG
CGCGCGGCCGTCCACCAGGACGGCACCCTGGAGGTCGCCCCGGCCGTCCCCCACTACCGC
ATCACCCGGCACGACCTGACGGGTCTGCGACCGGCCGAAGGGCCGGCCGCCGACGGCGGG
TCCCCGGTCGAGCGGGCGCTCGCCGACACCGCCGCCCGGCTGCGCGGCGGGACCTTCCCC
CTGGGCAGCCGGCCGATGTACGCCCTGGAGGCCAGCATCCTCCCGGACGGCACCACCGTC
CTGCACGTCGTCCTGGACGCGCTGCTCGCCGACGCGCGCTCCTTCGCCCTGCTCTTCGGC
CAGCTGTTCGCGTTGCACGACGGCGACTCGTCGGTGCTGGACGAGCCCGCCGACCCGGGC
CCGTACCTGCTCGGCCTCCCCGCGCACGGCCAGGACGGTTCGGCGGAGGCCGCCCGGCTC
GCCTGGCGGGAGAAGTTCGCCGCCCTGCCCGCAGGCCCCCCGCTCCCCGACCCGGCCCCG
CAGGCCGCCCGGCTGCACCGCCGCACGGACCTCGGGTCCTGGCGGCGCCTCACCGAGCGG
GCAGCCGCGATCGGCGTCCCGGCCGACATGGTGCTGCTGACCGCTTACACCGACGAGCTG
CGCCGCACGTTCGGCCCGGAGCCGTTCACCGTGACCGTGGTCTCCTGGGACCGGCCCGCC
GGCCTGGCCCACGCGGACCGCATGGTTGCCGACTTCACCCAGCTGGCCTGGGTGGTGGTC
GACGACACGCTGCCGGCCGACTTCGCGCAGCGGGCCCGCGAGCTGTGGGGCCGGGTCCGC
GCAGACCTGGAGCGCGGCGAGTTCCGGCCCGGCCTGGCCGAGCTGCGGGGCCGGGTCTTC
CGCTCCGGCGGCAGGCTGCGGCTGCCGGTGGTCTTCACCCGGGTACCCGAGATCGATCCC
GCCCTGCACCCGCGCGGCGTACGGCTGCGCGAGAGCCAGTCGCAGACCGCCCAGGTCGCG
CTGGACCACGTCCCGCTGCTCGTCGGCGACGACCTGGTCGGCCAGTGGGACGCCGCCGAG
GGCTGCCTCTCCGCCGACCGGATGGACACCATGTTCGAGGGCTACGCGCGCCGTATCCGC
TCCTTCGTCGAGTCCGCCGGGTCCGCGGGGTCCGCGGGGTCCGTCGAGTCCGCCGGGTCC
GCCGGGTCCGCCGACGAGCTGTCGGCGACCATGACCGGCCTGCTCGCCGAGACGCTGTCC
CGCCACCCCGACCGCCCGGCCGTCCACTGGGACGGGCGCGTCGTCGACTACCGCGAGCTC
GACCACCGTACGGCCCGGCTGGCCCACCAGCTGATCGCCTCCGGGATCCGCCCTGGCGAC
CACGTCGCCGTGCACATGAACCGCTCCGACGACCTGGTGGTCGCGCTGGTCGGCATCGTG
CGCGCCGGAGCCGTCTACGTCCCCGTCGACCCGGCCAACCCGCCGGAGCGGGTGCGCTAC
CTGCTGGAGGACAGCGGTGCGCGCGTGGTGGTCGCCGACGCGGCGCTCGCAGCCGTACCG
GCCGCCGCCGGCGCGGTCGTCCTCTGCCAGGACCGTGACGAGGACCGGGCGCTGCTGGCG
TCCCGCCCGGTGACGCCGCCCCAGGTGGAGGTGGGCCCGGACGACCCCGTCTACACGATC
TACACCTCGGGCACCACCGGCAAGCCCAAGGGCTGCCGCAACACCCACCGGGGCTTCGTC
AACCGGGTTCGCTGGATGCAGGACCGCTTCCCGCTGGGCGCCGATGACCGGGTCGCCCAG
AAGACCCCGTACGGCTTCGACGTCTCGGCCTGGGAGTTCTTCTGGCCGCTGCTGGCCGGG
GCGTCCATCGTGGTCGCCCGGCCCGGCGGCCACGTCGACCCCGGCTATCTCGCCCGGCTG
CTGCGCGAGGAGCGGGTGACGGTCGCCCACTTCGTGCCCTCCGTGCTCGGCCTGTTCCTG
CGGGACCGAGCGGCGTCCGACTGCGCATCGCTGCGGTACGTCTTCGCCAGCGGCGAGGCG
CTTCCTGTCGCGACCATGAAGCGGTTCTTCCAGGTCCTGCCGGACGGCGCCGAGCTGCAC
AACCTGTACGGCCCGACCGAGGCCGCCATCGACGTGACCCACTGGGCGTGCCGTCCCGAC
TGGGACGAGCCCACCGTGCCCATCGGCCGGCCGATCGCCCGCACCCGCATCCACGTGGTG
GACGAGCGGATGGCACGGGTCCCGGACGGCACGCCGGGCGAGATCGTCATCGGCGGGGCG
GGCGTCGCCCTCGGCTACCACGGCCGGCCCGAGCTCACCGCCGAGCGCTTCGTGGCGTCG
CCGTTCGCCGACGACCCGTCACCACGCCTGTACCGCACCGGCGACCTGGGACAGCTCGGC
CCGGACGGCGAGATCAGGTACCTCGGCCGGATCGACGGCCAGTTCAAGCTCCGCGGCCTG
AGGATCGAGCCGGAGGAGGTCGAGGCCGCGCTCACCGAGCTGCCCGGGGTGTCCGAGGCC
CGGGTGCTCCCGGTCACCGACCCGGCCACGGGCGAGCAGATCCTGGCTGCGGTATGCGTC
GAGGCCGACGGCACCCTGGCCCCGTCCGTCGGGCAGATGCGCCGCGACCTGGCCCGCTCC
CTGCCGTCGTACCTCGTGCCGAGCAGCTTCCGGTTCGTGGACCGGCTGCCGCTGACGGCC
AACGGCAAGCTCGACCGCCGGGCCGCCACGGCTCTCTTCGGCACCACCCCGCCGGCCGCT
CCTGCCGCTCCGGCTCCCGTTGCTCCGGCTCCCGTCGTCGTTCCGGATCCGGCTGCTGCC
GCCGCCCCCCGGCCCCCCGCTCTCACCGGCCACCCGGCCCCCGCCATCGAGGAGGACCCC
GTGTACGACCCCCGCAACGGACGACCCGACGAGGGAACCGCCGCGCTCGTCGGGGCGGCC
GTCGCCGACTGCCTGCGGCTGGAGGTGGTCGACCCCGACGCCGACCTGTTCGACCTGGGC
GCGACCTCGTTCACGATGATCCGGCTGGCCCAGGAGATCGAGCGGCTGACCGGTGTCGCC
CTGTCCGTCGACGCCCTGATCAGCGGGCCGACCGTCACCGCGCTGCTCGCTGCCGTCCGC
GCCGGCCGGGCCGCCGCCGACCGGACCGAGCCGGAGACGACCGGAGCGGCCGTCCCTCCC
GGTCCGCAGGCGGACGTGGCGGCAGTGGCGGACCTGGCCGCCGGCCTGCTCGGCCTGGCG
GAGGCCGACCCGGACACCGACCTGTTCGACCTGGGCGCGACCTCGTTCACGATGATCCGG
CTGGCCCAGGAGCTCGCCGAGCGGTTCGGGGCGGACGTCCCGGTCGACGCCCTGATCCAG
ACCCCCACCGCCCGCGGCATCGCCGCGAGCCTGGCCCCCGCTTCCGCGCCCCAGGCGGCC
GCCGCGCCGCGGGCAGCAGCATCCGCTGCCCGCACCGACATCCGGATCGCCCTCGACCCG
CAGGCCAAGGCCGCGTTCAAGGAGGCCAGGGTCGCCGAGCGCCGGTTGCCCGGGTCGCTG
GCCCGGCTGCCGTTCCCGGATCCCACCCCGCAGGACCGGCGGGCGTTCTACGACGCCTCG
TCCTTCCGCGAGTTCGCCGACGGGCCACTGCCCGGCGACCGGCTCACCGAGCTGCTGGGC
ACCCTGGCCCGCGGCGAGCTCGACGGCCGGGCCAAGCACCGCTACCCGTCCGCAGGCGGT
TTCTACCCGGTGCAGGTCTACCTGTACGTCAGGCCGGGGGCCGTGGAGGGCGTCGACGGC
GGCCTCTACTACCTGCACCCGGGCGAGCGCGCCCTGGTGGCGATCGACCCGCAGGCCCGC
TTCGGCACCGACGTCCACGTCTTCCACAACCGCGCCCTGGTGGACGCCTCCGCCTTCGGC
GTCTTCCTGGTGTCCACCCCGGCGGCCATCGCGCCGGCGTACGGCGAGCGCAACGCCGGC
CGGTTCTCGATGATCGAGGCGGGGCACGTCGCCCAGCTGCTGCTGACCGCCGGGCCCGAG
CGCGGCCTCGGCATGTGCGCAGTGGGGGAGATGGACTTCGGCGCGGTGCGCGGGCACTTC
GGCCTCCAGGACGACCAGGAACTGCTGGTCTCGCTGTGGGGCGGTGCCCTGTCCGGGCCG
GCGGTGCTCCGCCGGGCCGAGCTGGTCGCCGCCGAGCGCCCTCAGGAGAGCGCGCCGGTG
CCGTCCGGCCCGCGCCCGGTGGCCGTGGTCGGCTTCGCGGCCCGGCTGCCCGGGGCCGAC
GACCTGCGCGGGCTGGACGCGATGCTGGCGGCCGGCGACTGCGCTCTCGGCCCCGCCCCG
CAGGAGCGCTGGGCCCCGCTCCGGAGCAACGCCCGGCGCGCCGGCGCTCGCGTCGGCGGC
TACCTGCCCGACGTGACGGCCGTGGAGGTCGAGGAGTTCGGGCTCGCGGACGCCGAGGTG
GCCGCCGTCGACCCGCAGGAGCGGCTGCTGCTGACGGTCACCCGACACTGCCTGGAGGAT
GCCGCGATCACCCCCGAGCGGCTGTCGCAGACCGGCCAGGTCGGTGTGTTCGTCGGGTCG
ATGTGGCAGGACCACGCGCTCCACGGGGTGGCGGCCCGGGCCGAGGGACGGACGGGCACC
CACGCCACCCGCGGCGGACTCGCCCACCGCATGTCGCATGCGTTCGGCCTGACCGGCCCG
AGCCTGGTGATCGACACCGGCTGCGTCTCCGGGCTCGCGGCCGTCGAGGCGGCCTTCCGG
GCCGTCGCCGACGGCCGGTGCGAGGCCGCCGTCGCGGCCGGTAGCAACCTGGTGCTGCAT
CCGGACCACCTGGACGTGCTGTCCGAGCTGGGACTGGTCGCCGAGCAGGAGGACTCCTGC
GCGTTCACCGACCGGGCCAGCGGCTGGCTGGTCGGGGAGGGCGTCGGCGCGGTCCTCCTC
AAGCCCCTCGACCGTGCCTTGGAGGACGGCGACCCCGTCCACGCCGTGCTGCGCGGCGGC
GCGCTCCTGCACTCGGGAACGACCCGCCAGTTCGGGATCCCGGACCCGCGCCGCCAGGAG
CAGGTGATGCGGGCCGCGCTCGCCGACGCCCGGCTGACGGCCGGGGACATCGGCTACGTC
GAGGCGGCGGCGGCCGGCGCGGCGCTGGCCGACGCGCTCGAGTTCACTGCGCTGGGACGG
CTGTTCGGCGCCGCCGGCGTCGATGGCGGCGCTGACGTCGAGGGTGCGAGCGGAGCCGGG
AACGGCGCCCGAGCGGGCCTCGGGCCCGTGCCGGTCGGCTCGGTCAAACCGAACACCGGC
CACCTGGAGGCAGCCTCCGTCTTCGCCCAGCTCGGCAAGCTCATCGCCCAGTTCCGCCGG
GACCGGCTCTACCCGACCCGACTCACCTCGGCCGCCAACCCGGCACTCGCCCCGTACCGC
GGATCCGTGGCCCTGGCCGGCCCGTCCGCCGACCAGTGGCGCACCGCGCCCGGCGGCACC
CGACGGGCCCTGGTGAACGGCTTCGCGGGCGGCGGATCGTACGGCAGCCTCGTGGTCGAG
GAGCCGCCGGCCGCCGCGACCGCGGCACCGGCCGACGCCGACACGGCTGTCAGCGAGGGG
ACCGAGGTCCTCGTACTGTCCGCGGACAACCCGGAGAACCTGGCCCGCTGGGCCCGCTCC
CTCGCGGAGGAACTGGACGCCGACCCCGGTCTCGACCTCGCCGCCGTCGCCCGTACGCTG
CGGGAAGGACGCCGGGCACGCGCTGTCCGCGGGGCGGTGGCCGCCGACCGTGGCCGGGCT
GCCGGGGCGCTGCGCACCCTCGCCGAGCGCGTGCTGCGCGACGGCACCGGCGCCACCGTC
GAGGCCGCCCGGACGACGGCGGACCAGCAGGCGCTGACGGCGCTCTGGTCGGCCGGCGGC
GAACTCCCGGTGCCCGCCACGTCCGCCGTGCCGCGCCGCCGGCCGCTGCCGCCGGTGCCG
CTGTCCGTCCGCCGGGTACCGCTCCCGGTGCCTGCCGCCGCATCCGCGCGGCCGGAGAAG
GAGCAGCAGCCGGACGGCCCGACCGGGACCGGGCCGACGCCGTTCGAGCGGATGGCCGGC
ATCGTCGCCCAGGAACCGGGGGCGGATCCGGACCGGCTCGCCCCCGCCGACGACCTGTTC
GCGATGGGCGTCACCAGCCGCCAGTTGCTGCGGATCGCCGCCCGGGTGGCCGACGACGGA
GGCAGCGAACTCCCCCTGGAGTCGCTCTTCACCGCCCCGGACCTCGCGGCCCTGGCCGAG
CTCGCCTTTCCCATAGCCGTACCCGCCTGA
[8] C12..301
[8] C465..759
[8] A937..1342
[8] serine1107..1211
[8] PCP1473..1540
[8] PCP1565..1632
[9] ks1905..2286
[9] ACP2514..2583
[8] C34..903
[8] C1393..2277
[8] A2809..4026
[8] serine3319..3633
[8] PCP4417..4620
[8] PCP4693..4896
[9] ks5713..6858
[9] ACP7540..7749

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000415 Nitroreductase-like (Domain)
 [1690-1875]  5.09999882439978e-15 SSF55469
SSF55469   Nitroreductase
 [1700-1871]  2.5e-11 G3DSA:3.40.109.10
G3DSA:3.40.109.10   G3DSA:3.40.109.10
 [1701-1870]  3.7e-12 PF00881
PF00881   Nitroreductase
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [937-1342]  3.39999999999996e-121 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [12-301]  3.2e-29 PF00668 [465-759]  1.4e-21 PF00668
PF00668   Condensation
IPR009081 Acyl carrier protein-like (Domain)
 [1468-1542]  1.09999999999999e-37 G3DSA:1.10.1200.10 [1567-1634]  1.09999999999999e-37 G3DSA:1.10.1200.10 [2516-2581]  1.09999999999999e-37 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1473-1540]  PS50075 [1565-1632]  PS50075 [2514-2583]  PS50075
PS50075   ACP_DOMAIN
 [1466-1564]  2.59999946718995e-13 SSF47336 [1566-1669]  1.59999889349252e-13 SSF47336 [2507-2581]  1.69999922284049e-09 SSF47336
SSF47336   ACP_like
 [1481-1539]  8.9e-09 PF00550 [1568-1629]  7.7e-12 PF00550 [2519-2581]  1.6e-06 PF00550
PF00550   PP-binding
IPR010071 Amino acid adenylation domain (Domain)
 [937-1342]  TIGR01733
TIGR01733   AA-adenyl-dom
IPR013624 Non-ribosomal peptide synthetase (Domain)
 [326-375]  2.7e-10 PF08415
PF08415   NRPS
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [1905-2146]  2.89999999999999e-51 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [2154-2286]  1.3e-20 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [1905-2156]  2.70000000000002e-60 G3DSA:3.40.47.10 [2159-2344]  1.9e-29 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1897-2344]  1.3000049540733e-59 SSF53901
SSF53901   Thiolase-like
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1474-1543]  5.09999882439977e-08 SM00823 [1566-1635]  1e-08 SM00823
SM00823   PKS_PP
SignalP No significant hit
TMHMM No significant hit