close all open/close all

CDS information : Virg_00190


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction58,367 / 54,744 / - [in whole cluster]
29,991 / 26,368 / - [in contig]
Locationcomplement(54744..58367) [in whole cluster]
complement(26368..29991) [in contig]
TypeCDS
Length3,624 bp (1,207 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)hybrid non ribosomal peptide synthetase-polyketide synthase
Gene
Gene (GenBank)virG
EC number
Keyword
  • virginiamycin M
Note
Note (GenBank)
Reference
ACC
PmId
[17350183] Characterization of biosynthetic gene cluster for the production of virginiamycin M, a streptogramin type A antibiotic, in Streptomyces virginiae. (Gene. , 2007)

close this sectionPKS/NRPS Module

M6
7
KR56..240
ACP342..410
KS477..842
ACP1131..1200

close this sectionSequence

selected fasta
>polyketide synthase [hybrid non ribosomal peptide synthetase-polyketide synthase]
MLTADGTPDARRLLAEIAAPAAEHGHLADLRSARRLRRVLVPVPLPGTRPFVRQDGVYLV
SGGAGGIGLALARHLTDRPGTRVVLCGRTAWDDLAEATRSAVSGSDRLRYARADVTDPEA
AAALVAEVVRTEGALHGVFHAAGVVRDGYLVRKDPRDVADVLAPKILGARALDEATAALP
LDAFVLFSSVAAVTGNLGQSDYAFANGFLDGFATRRAGQVARGERHGRTLSVQWPLWDVP
GMSIPEPVLEVVAQHTGMAPLPAAVGLAALERLLAADGPEVVSLFHGDAATWRAHLAALH
LERPAAAGQVTAAAPAAPAPSDTPVVASADPAAADDGRRAELADRVSRTVADTIGRPAGS
IGGHTSLESMGLDSVMIRALASRLSAEVAPVGPEMLFGLRDLDELVDHLVAARPVPVAEP
ATPAVPPAPAATAATVFAPVAPADPAVVPAAPAALPVPAAAPASASRTLPAPSADDRFAI
IGISGRYPQAPDLDAFWQNLLNGKDTASDLPTDRWPDAAGVNARGHFLEGVDAFDPTFFG
LSAHDGTLLDPQERLFLEVAWEALEDAGYTGSRLHDLVAPDGERRSVGVFAGITSSDYKL
LGAERWAAGHREMPSGHYWSLPNRLSYLLDLRGPSQPVDTACSSSLVALHLALDALRRGE
CAAALVGGVNLYVHPSRFRMLRRSGFLAEDGLCRSFGAGGAGFGPGEGGGAVVVKPLAVA
LADGDTVHAVVRGSAVAHGGRTNGFTAPSPWAQARVLRAALRNSGTDPETVNVIEAHGTG
TELGDPVELAGLQDAYGSGRVPCSLGSVKSAVGHGESAAGIAALTKVVLQLRHGELVPTL
HADPVNPGLRLEDTRFVLQHTPGRWERLTGADGSPLPRRAGISSFGAGGVNAHVIVEEYL
PEPHGRAAAAEPGRPELVLLSAPTREHLAATADRLARRLEGPEAPADLRAVAYSLRTGRS
AMDCRLAVVATDTAGLAAALGAFARSADAGEGESAVRYADLRDGRRAHRDLDTVPETTAF
LADLWRNRRLHQLGELWLSGLDIERAAPREPGTRLVPLPTSAFLRRRLWITDPVTADTTP
TPDPLPTPDPLPVPLSAPAPAPAPAPQPAPTTTPAPAAAPAAAPARSGEAVTEQLSRLVA
GFVPDAAGSVDPDRTLLEHGIDSINLMNLRFEITERFGRTLPLQLLSESTVPVLAAHLSA
DRAHDRA
selected fasta
>polyketide synthase [hybrid non ribosomal peptide synthetase-polyketide synthase]
GTGCTGACCGCGGACGGCACGCCGGACGCGAGGCGGTTGCTCGCCGAGATCGCCGCGCCG
GCCGCCGAGCACGGGCACCTGGCCGACCTCCGCTCCGCCCGGCGGCTGCGCCGGGTGCTG
GTACCGGTTCCGCTGCCCGGCACCCGCCCCTTCGTGCGCCAGGACGGCGTGTACCTGGTC
AGCGGCGGTGCGGGCGGCATCGGCCTGGCACTGGCCCGGCACCTGACGGACCGTCCGGGC
ACCCGCGTGGTGCTCTGCGGACGGACCGCGTGGGACGACCTCGCCGAAGCGACCCGCAGC
GCCGTCTCCGGCAGCGACCGCCTGCGCTACGCCAGGGCCGACGTCACCGACCCCGAGGCC
GCCGCCGCGCTCGTGGCCGAGGTCGTCCGGACCGAGGGCGCCCTGCACGGCGTCTTCCAC
GCCGCCGGCGTGGTGCGCGACGGCTACCTGGTGCGCAAGGACCCCCGGGACGTGGCCGAC
GTGCTGGCGCCCAAGATCCTCGGTGCGCGGGCGCTGGACGAGGCGACCGCGGCCCTCCCG
CTGGACGCGTTCGTGCTGTTCTCCTCGGTGGCCGCGGTGACCGGCAACCTCGGCCAGAGC
GACTACGCGTTCGCCAACGGCTTCCTCGACGGCTTCGCCACCCGCCGTGCCGGGCAGGTG
GCGCGCGGTGAGCGGCACGGCAGGACGCTGTCCGTGCAGTGGCCGCTCTGGGACGTCCCC
GGCATGAGCATTCCCGAGCCGGTCCTGGAAGTGGTGGCCCAGCACACCGGCATGGCGCCG
CTGCCCGCAGCCGTCGGGCTCGCGGCTCTGGAACGCCTGCTGGCCGCCGACGGCCCCGAG
GTCGTCTCGCTCTTTCACGGCGACGCGGCCACGTGGCGGGCCCACCTGGCCGCCCTCCAC
CTGGAGCGGCCGGCCGCGGCCGGCCAGGTGACGGCCGCCGCTCCCGCCGCTCCCGCCCCT
TCCGACACCCCCGTCGTCGCGTCGGCCGATCCTGCTGCGGCGGATGACGGCCGGCGCGCC
GAACTGGCCGACCGGGTCAGCCGGACGGTGGCCGACACCATCGGCCGCCCCGCGGGCAGC
ATCGGCGGTCACACCTCGCTCGAGTCGATGGGGCTGGACTCCGTCATGATCCGCGCCCTC
GCCTCCCGGCTCAGCGCCGAAGTGGCACCGGTCGGGCCGGAGATGCTCTTCGGCCTGCGC
GACCTGGACGAGCTGGTCGACCACCTGGTCGCCGCCCGGCCGGTCCCCGTAGCGGAACCG
GCCACACCGGCGGTCCCGCCGGCACCCGCCGCCACGGCGGCCACGGTCTTCGCACCGGTG
GCTCCGGCGGACCCGGCCGTTGTCCCGGCCGCCCCGGCCGCCCTGCCCGTCCCCGCCGCC
GCGCCGGCATCCGCCTCCCGTACGCTGCCGGCGCCGTCCGCCGATGACCGCTTCGCGATC
ATCGGCATCAGCGGCCGCTACCCGCAGGCGCCCGACCTGGACGCCTTCTGGCAGAACCTG
CTGAACGGCAAGGACACCGCCTCCGACCTGCCCACCGACCGCTGGCCGGACGCCGCGGGC
GTCAACGCCCGGGGCCACTTCCTCGAAGGCGTGGACGCGTTCGACCCGACGTTCTTCGGA
CTGTCCGCCCATGACGGGACCCTGCTCGACCCGCAGGAACGGCTGTTCCTGGAGGTCGCC
TGGGAGGCGCTGGAGGATGCCGGATACACCGGCTCGCGTCTGCACGACCTCGTCGCGCCG
GACGGCGAGCGCCGCAGCGTCGGCGTCTTCGCCGGGATCACCTCCAGCGACTACAAGCTG
CTGGGCGCCGAGCGCTGGGCAGCCGGACACCGGGAGATGCCCTCCGGGCACTACTGGAGC
CTGCCCAACCGGCTGTCCTACCTGCTGGACCTGCGCGGTCCGAGCCAGCCGGTCGACACC
GCCTGCTCGTCCTCCCTGGTCGCGCTGCACCTCGCGCTCGACGCGCTCCGCCGCGGCGAG
TGCGCGGCCGCTCTGGTCGGCGGGGTCAACCTGTACGTCCACCCCTCCCGGTTCCGGATG
CTGCGCCGGTCCGGCTTCCTGGCCGAGGACGGCCTGTGCCGCAGCTTCGGCGCCGGCGGG
GCCGGCTTCGGCCCGGGCGAGGGCGGCGGTGCCGTCGTGGTGAAACCGCTCGCCGTCGCC
CTGGCCGACGGTGACACCGTGCACGCGGTGGTCCGCGGCAGCGCGGTCGCACACGGCGGG
CGGACCAACGGCTTCACCGCGCCGAGCCCGTGGGCGCAGGCACGGGTGCTCCGTGCCGCG
CTGCGGAACTCCGGCACCGACCCGGAGACCGTCAACGTGATCGAGGCGCACGGCACCGGG
ACGGAACTCGGCGACCCGGTCGAGCTGGCCGGCCTCCAGGACGCGTACGGCTCCGGCCGC
GTGCCCTGCTCGCTGGGGTCGGTCAAGTCCGCGGTGGGGCACGGCGAGTCGGCGGCCGGC
ATCGCCGCGCTGACCAAGGTGGTCCTCCAACTGCGCCACGGCGAGCTGGTCCCCACCCTG
CACGCCGACCCGGTCAACCCGGGCCTGCGCCTGGAGGACACCCGCTTCGTCCTCCAGCAC
ACCCCGGGCCGCTGGGAGCGACTGACCGGCGCGGACGGCAGCCCGCTGCCGCGACGGGCG
GGCATCAGCTCCTTCGGCGCCGGCGGAGTCAACGCCCACGTCATCGTCGAGGAGTACCTG
CCCGAGCCGCACGGCCGCGCGGCCGCCGCCGAGCCGGGCCGCCCGGAACTGGTCCTGCTC
TCCGCCCCGACGCGCGAGCACCTGGCGGCCACCGCCGACCGCCTCGCGCGCCGGCTGGAG
GGCCCGGAGGCGCCCGCCGACCTGCGGGCGGTGGCGTACAGCCTGCGCACCGGCCGGTCC
GCCATGGACTGTCGCCTCGCCGTGGTGGCGACCGACACCGCCGGCCTGGCGGCCGCGCTC
GGCGCCTTCGCCCGCTCGGCCGACGCCGGCGAGGGGGAGTCCGCCGTGCGGTACGCCGAC
CTGCGGGACGGCCGCCGTGCCCATCGGGACCTGGACACGGTGCCCGAGACGACCGCGTTC
CTCGCCGACCTGTGGCGCAACCGGCGCCTGCACCAACTCGGCGAGCTCTGGCTGTCGGGC
CTCGACATCGAGCGTGCCGCGCCCCGTGAGCCGGGCACCCGGCTGGTGCCGCTCCCCACG
TCGGCGTTCCTGCGGCGCCGGCTCTGGATCACCGACCCGGTCACGGCGGACACCACGCCC
ACACCGGACCCTCTGCCCACACCGGACCCCCTGCCCGTACCGCTGTCCGCTCCGGCACCG
GCACCGGCCCCCGCCCCCCAGCCCGCGCCGACCACCACCCCGGCCCCGGCAGCCGCGCCC
GCCGCAGCGCCTGCCAGATCCGGGGAAGCGGTGACCGAGCAGCTGTCGCGCCTCGTCGCG
GGCTTCGTACCCGACGCGGCGGGGTCGGTCGACCCCGACCGCACCCTGCTCGAACACGGC
ATCGACTCGATCAACCTGATGAACCTGCGCTTCGAGATCACCGAGCGGTTCGGGCGGACC
CTGCCGCTGCAGTTGCTCAGCGAGTCGACCGTCCCCGTGCTCGCCGCCCACCTGTCCGCC
GACCGCGCCCACGACCGGGCCTGA
[6] KR56..240
[6] ACP342..410
[7] KS477..842
[7] ACP1131..1200
[6] KR166..720
[6] ACP1024..1230
[7] KS1429..2526
[7] ACP3391..3600

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [340-411]  8.30000000000004e-20 G3DSA:1.10.1200.10 [1130-1201]  8.30000000000004e-20 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [345-409]  7.3e-07 PF00550 [1134-1197]  1.5e-06 PF00550
PF00550   PP-binding
 [342-410]  PS50075 [1131-1200]  PS50075
PS50075   ACP_DOMAIN
 [335-492]  1e-13 SSF47336 [1127-1201]  5.79999653854781e-10 SSF47336
SSF47336   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [56-238]  1.9e-52 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [477-718]  1.9e-67 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [728-842]  8.30000000000004e-40 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [476-731]  6.99999999999989e-77 G3DSA:3.40.47.10 [732-900]  8.89999999999994e-54 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [468-898]  4.30000170645869e-78 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [55-274]  3.2e-43 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [633-649]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [56-240]  7.2000271977897e-48 SM00822
SM00822   PKS_KR
SignalP
 [1-51]  0.088 Signal
Bacteria, Gram-positive   
TMHMM No significant hit