close all open/close all

CDS information : Virg_00200


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction60,604 / 58,361 / - [in whole cluster]
32,228 / 29,985 / - [in contig]
Locationcomplement(58361..60604) [in whole cluster]
complement(29985..32228) [in contig]
TypeCDS
Length2,244 bp (747 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
Gene
Gene (GenBank)virF
EC number
Keyword
  • virginiamycin M
Note
Note (GenBank)
Reference
ACC
PmId
[17350183] Characterization of biosynthetic gene cluster for the production of virginiamycin M, a streptogramin type A antibiotic, in Streptomyces virginiae. (Gene. , 2007)
[26982529] Characterization of Intersubunit Communication in the Virginiamycin trans-Acyl Transferase Polyketide Synthase. (J Am Chem Soc. , 2016)

close this sectionPKS/NRPS Module

M6
KS1..341

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MPPERWRTEEFYDPDPAAEGRSVSRWGAYVADADRFDADFFRMTPREAELTDPQARLFLQ
EAWRALEHAGRDARSLAGTRCGVYAGVMLNDYQDLVERESPYKRLPQVMQGNSNSILAAR
IAYHLDLKGPAVTVDTACSSSLTALHLACQSLWLGETDLTVVGGVTLYLTELPHVFMSAA
GMLSPNGRCRPFDAAADGIVPGEGCAVVVLKPLSKALADGDPVHAVIRASGLNQDGRTNG
ITAPSARSQTALVRDTLQRFAVDPAGIDYVECHGTGTPLGDPIEVTALNEAFAGAGLAPA
SVPIGSVKGNIGHTSAAAGLAGLLKAAGVVRTGLVPPSLHYARANPQIPFDQGPFTVAGE
RRELGRPDGGRPRRATVSSFGFSGTNAYVVVEQAPEQAARPAGDDGAPPVLVPLSGRRAD
APAAHAADLARWLRGPGSDASPADVAHTLAVARTHHTYRFALLVSGRDELLESLDLLAAG
SADPRRTDTAPDAAAPDAAVRRAQAALLARLVERAGENPGPVELAALAKLYTQGHTVDWA
AVSPPARHRRLSLPAYPFAPHRHYVERPAPVTPPTPAATSALAEASHGTPAEPAGARTPQ
EALADVPLTEPVLHRQEWIPAPLPAAAPAPTAPVLVHDPAGDLAAALAATGLDVHRLGGD
RTAAEALRATGAQVVTVVLRLTPPADGAPATAVDLAAFEAARAALAVLRTQQLTLLAVTA
DPPEPTRPERSSRPSVRRTPGSPAARC
selected fasta
>polyketide synthase [polyketide synthase]
GTGCCGCCGGAGCGCTGGCGCACCGAGGAGTTCTACGACCCGGACCCGGCCGCCGAGGGC
CGTTCGGTCTCCCGCTGGGGCGCCTACGTCGCGGACGCCGACCGCTTCGACGCGGACTTC
TTCCGGATGACTCCCCGCGAGGCCGAGCTGACCGACCCCCAGGCGCGCCTTTTCCTCCAG
GAGGCGTGGCGAGCGCTGGAGCACGCGGGCCGGGACGCCCGCTCGCTCGCCGGAACCCGC
TGCGGCGTCTACGCGGGCGTCATGCTCAACGACTACCAGGACCTGGTCGAGCGGGAGAGC
CCGTACAAGCGGCTCCCCCAGGTGATGCAGGGCAACTCCAACTCGATCCTCGCCGCCCGG
ATCGCCTACCACCTGGACCTCAAGGGCCCCGCCGTCACGGTGGACACCGCCTGTTCGTCC
TCGCTGACCGCGCTGCACCTGGCCTGCCAGTCACTGTGGCTCGGAGAGACCGACCTGACG
GTGGTCGGCGGCGTCACTCTGTACCTGACCGAACTCCCGCACGTGTTCATGAGCGCGGCC
GGGATGCTGTCCCCCAACGGGCGCTGCCGACCGTTCGACGCCGCCGCCGACGGCATCGTG
CCGGGCGAGGGTTGCGCCGTCGTGGTGCTCAAGCCGCTGTCGAAGGCGCTCGCCGACGGC
GACCCCGTGCACGCGGTGATCCGGGCGTCGGGGCTCAACCAGGACGGGCGCACCAACGGC
ATCACCGCCCCCAGCGCCCGCTCGCAGACCGCCCTGGTCCGCGACACGCTGCAGCGCTTC
GCGGTGGACCCCGCCGGCATCGACTACGTCGAGTGCCACGGCACCGGCACCCCGCTCGGC
GACCCGATCGAGGTCACCGCCCTCAACGAGGCGTTCGCCGGCGCCGGACTGGCGCCCGCC
AGCGTGCCGATCGGATCGGTCAAGGGCAACATCGGCCACACCTCGGCCGCGGCCGGCCTG
GCCGGGCTGCTGAAGGCGGCCGGCGTGGTGCGCACCGGGCTGGTCCCGCCGTCGCTGCAC
TACGCCCGGGCCAACCCGCAGATCCCGTTCGACCAGGGCCCGTTCACGGTTGCGGGGGAG
CGCCGAGAGCTGGGCCGCCCCGACGGCGGCCGCCCCCGCCGGGCCACCGTCAGCTCCTTC
GGCTTCAGTGGCACCAACGCCTACGTCGTCGTCGAGCAGGCCCCCGAGCAGGCCGCCCGT
CCCGCCGGCGACGACGGTGCCCCGCCCGTCCTGGTCCCGCTGTCCGGCCGGCGCGCCGAC
GCGCCCGCCGCCCACGCCGCCGACCTCGCCCGCTGGCTGCGCGGCCCGGGCTCCGACGCG
TCGCCCGCCGATGTCGCCCACACCCTGGCCGTCGCCCGCACCCACCACACGTACCGCTTC
GCGCTGCTGGTCTCCGGCCGGGACGAACTGCTGGAGTCGCTGGACCTGCTCGCCGCCGGT
TCGGCCGACCCGCGGCGCACCGACACCGCGCCCGACGCCGCAGCGCCCGACGCCGCCGTC
CGCCGCGCCCAGGCCGCGCTGCTGGCCCGGCTGGTGGAGCGGGCGGGCGAGAACCCCGGC
CCGGTCGAGCTGGCGGCCCTGGCCAAGCTGTACACGCAGGGACACACGGTGGACTGGGCC
GCGGTCAGCCCGCCCGCCCGGCACCGGCGGCTCTCCCTGCCCGCCTACCCCTTCGCCCCG
CACCGCCACTACGTCGAACGCCCCGCCCCCGTCACACCCCCGACGCCTGCCGCCACTTCG
GCGCTCGCCGAGGCGTCGCACGGGACTCCGGCCGAGCCGGCCGGCGCCCGCACCCCGCAG
GAGGCCCTGGCCGACGTGCCGCTCACCGAACCGGTTCTGCACCGGCAGGAGTGGATCCCC
GCCCCGCTCCCGGCCGCCGCACCTGCCCCCACGGCCCCGGTGCTCGTGCACGACCCGGCC
GGCGACCTGGCGGCCGCACTCGCCGCCACCGGGCTCGACGTCCACCGGCTGGGCGGGGAC
CGGACCGCCGCCGAGGCGCTGCGGGCCACCGGCGCGCAGGTCGTCACCGTCGTGCTGCGG
CTCACCCCTCCCGCGGACGGCGCCCCCGCGACCGCCGTGGACCTGGCGGCGTTCGAGGCC
GCCCGCGCGGCGCTGGCCGTCCTGCGCACCCAGCAGCTCACCCTGCTGGCCGTCACCGCG
GATCCACCCGAGCCGACGCGGCCGGAGCGCTCGTCCAGACCCTCCGTCAGGAGAACCCCC
GGCTCTCCGGCCGCGCGGTGCTGA
[6] KS1..341
[6] KS1..1023

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [1-216]  9.2000000000001e-75 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [224-341]  2.99999999999998e-37 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [4-227]  2.30000000000004e-79 G3DSA:3.40.47.10 [230-397]  4.2e-56 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1-396]  9.90001804798383e-82 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [129-145]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP No significant hit
TMHMM No significant hit