close all open/close all

CDS information : Virg_00210


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction61,742 / 60,990 / - [in whole cluster]
33,366 / 32,614 / - [in contig]
Locationcomplement(60990..61742) [in whole cluster]
complement(32614..33366) [in contig]
TypeCDS
Length753 bp (250 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative decarboxylase
Product (GenBank)enoyl-CoA hydratase
Gene
Gene (GenBank)virE
EC number
Keyword
  • virginiamycin M
  • C-12 methylation
Note
Note (GenBank)
Reference
ACC
PmId
[17350183] Characterization of biosynthetic gene cluster for the production of virginiamycin M, a streptogramin type A antibiotic, in Streptomyces virginiae. (Gene. , 2007)
Related Reference
ACC
P40802
PmId
[16757561] Convergence of isoprene and polyketide biosynthetic machinery: isoprenyl-S-carrier proteins in the pksX pathway of Bacillus subtilis. (Proc Natl Acad Sci U S A. , 2006)

close this sectionSequence

selected fasta
>putative decarboxylase [enoyl-CoA hydratase]
MVHLSWQGPVAVIRMADHEGRNTFGPALSRGLVDAVDRAVAEERTRVLVVEGMPELFCAG
GSQRELVHFARGDGSFDTDDFFRVLARCPLPVVAAVQGHAIGGGLVLALYADLAVFSERS
VYAANFMRYGFTPGMGATHLLPARFGHQLGTEMLYTARNHRGAELRERGAPVRVVAHDDV
ASTAHALAAGVANAPRASLELLKQDLAAPLLAATDAAIEREAAMHRTTFRLPEVMDRIVD
GYGAAGLRHP
selected fasta
>putative decarboxylase [enoyl-CoA hydratase]
GTGGTCCACCTGTCCTGGCAGGGACCGGTGGCCGTGATCCGGATGGCCGACCACGAGGGC
CGCAACACCTTCGGCCCGGCCCTCAGCCGCGGCCTCGTCGACGCCGTCGACCGGGCCGTC
GCCGAGGAACGCACCCGCGTCCTGGTCGTCGAGGGCATGCCCGAGCTGTTCTGCGCCGGC
GGGTCCCAGCGGGAGCTGGTCCACTTCGCCCGGGGCGACGGCAGCTTCGACACCGACGAC
TTCTTCCGGGTCCTCGCCCGCTGCCCGCTGCCCGTGGTGGCCGCGGTCCAGGGGCACGCG
ATCGGCGGCGGCCTGGTGCTGGCGCTCTACGCGGACCTCGCGGTGTTCAGCGAGCGGTCG
GTGTACGCAGCCAACTTCATGCGCTACGGCTTCACCCCCGGCATGGGCGCGACCCACCTC
CTGCCCGCCCGCTTCGGCCACCAGCTCGGGACCGAGATGCTCTACACCGCGCGCAACCAC
CGCGGCGCCGAGCTCCGCGAACGCGGGGCGCCGGTCAGGGTCGTGGCGCACGACGACGTG
GCATCCACCGCTCACGCGCTGGCCGCCGGCGTCGCGAACGCGCCGCGCGCCTCGCTGGAA
CTGCTCAAGCAGGACCTGGCCGCACCGCTGCTCGCCGCCACCGACGCGGCGATCGAGCGG
GAGGCGGCCATGCACCGCACCACCTTCCGGCTGCCCGAGGTGATGGACCGCATCGTCGAC
GGCTACGGCGCCGCCGGCCTCCGACACCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001753 Crotonase, core (Domain)
 [7-235]  1.99999999999999e-47 PF00378
PF00378   ECH
IPR018376 Enoyl-CoA hydratase/isomerase, conserved site (Conserved_site)
 [93-113]  PS00166
PS00166   ENOYL_COA_HYDRATASE
SignalP No significant hit
TMHMM No significant hit