close all open/close all

CDS information : Virg_00220


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction62,518 / 61,778 / - [in whole cluster]
34,142 / 33,402 / - [in contig]
Locationcomplement(61778..62518) [in whole cluster]
complement(33402..34142) [in contig]
TypeCDS
Length741 bp (246 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative enoyl-CoA hydratase
Product (GenBank)enoyl-CoA hydratase
Gene
Gene (GenBank)virD
EC number4.2.1.-
Keyword
  • virginiamycin M
  • C-12 methylation
Note
Note (GenBank)
Reference
ACC
PmId
[17350183] Characterization of biosynthetic gene cluster for the production of virginiamycin M, a streptogramin type A antibiotic, in Streptomyces virginiae. (Gene. , 2007)
Related Reference
ACC
P40805
PmId
[16757561] Convergence of isoprene and polyketide biosynthetic machinery: isoprenyl-S-carrier proteins in the pksX pathway of Bacillus subtilis. (Proc Natl Acad Sci U S A. , 2006)

close this sectionSequence

selected fasta
>putative enoyl-CoA hydratase [enoyl-CoA hydratase]
MRVVRGRGLLRAVLDRPERRNPIDAGLLTSLARALDQAESDQDCRVFVLSSTGEDFCAGT
DLSGGDPAPEPLPDGAELPYWTLLERLTRSPLATVAVVDGRATAGGVGLAAACDLVLAGE
RARFRLTEVLAGLVPAMALPFVARRTGEQRAFAATLRAEEFDAGAAHRVGLADLAGPRAE
DLLPPVLAGLGRTDRSTTAALKEYRARLFPRDARLGHDASRLLIERFAAPGTGQLLARLR
EAGAAA
selected fasta
>putative enoyl-CoA hydratase [enoyl-CoA hydratase]
GTGCGCGTCGTCCGCGGCCGCGGGCTGCTGCGGGCCGTCCTGGACCGCCCCGAGCGGCGC
AACCCGATCGACGCCGGACTGCTCACCTCGCTCGCCCGGGCCCTCGACCAGGCCGAGAGC
GACCAGGACTGCCGGGTGTTCGTCCTGTCGTCGACGGGCGAAGACTTCTGCGCGGGCACC
GACCTGTCCGGCGGCGACCCCGCTCCCGAGCCGCTGCCGGACGGCGCCGAACTGCCCTAC
TGGACGCTGCTGGAGCGGCTGACCCGCAGCCCGCTCGCCACCGTCGCCGTCGTCGACGGC
CGGGCCACCGCGGGCGGGGTCGGCCTGGCCGCCGCCTGCGACCTCGTCCTGGCGGGGGAG
CGGGCCCGCTTCCGGCTCACCGAGGTGCTGGCCGGGCTGGTCCCGGCGATGGCCCTGCCG
TTCGTCGCCCGCCGGACCGGCGAGCAGCGGGCGTTCGCCGCGACCCTGCGCGCCGAGGAG
TTCGACGCCGGCGCCGCCCACCGGGTCGGCCTCGCCGACCTGGCCGGCCCGCGCGCCGAG
GACCTGCTGCCCCCGGTGCTGGCCGGACTCGGCAGGACCGACCGGAGCACCACCGCGGCG
CTCAAGGAGTACCGCGCCCGGCTGTTCCCCCGGGACGCCCGCCTGGGCCACGACGCCTCG
CGGCTGCTGATCGAGCGGTTCGCCGCACCGGGAACCGGGCAGCTGCTGGCGCGGCTGCGC
GAGGCCGGAGCGGCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001753 Crotonase, core (Domain)
 [9-180]  4.80000000000001e-32 PF00378
PF00378   ECH
SignalP
 [1-34]  0.312 Signal
Bacteria, Gram-negative   
TMHMM No significant hit