close all open/close all

CDS information : Virg_00230


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction63,786 / 62,533 / - [in whole cluster]
35,410 / 34,157 / - [in contig]
Locationcomplement(62533..63786) [in whole cluster]
complement(34157..35410) [in contig]
TypeCDS
Length1,254 bp (417 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative 3-hydroxy-3-methylglutaryl-ACP synthase
Product (GenBank)HMG-CoA synthase-like protein
Gene
Gene (GenBank)virC
EC number
Keyword
  • virginiamycin M
  • C-12 methylation
Note
Note (GenBank)
Reference
ACC
PmId
[17350183] Characterization of biosynthetic gene cluster for the production of virginiamycin M, a streptogramin type A antibiotic, in Streptomyces virginiae. (Gene. , 2007)
Related Reference
ACC
P40830
PmId
[16757561] Convergence of isoprene and polyketide biosynthetic machinery: isoprenyl-S-carrier proteins in the pksX pathway of Bacillus subtilis. (Proc Natl Acad Sci U S A. , 2006)
ACC
Q9FD71
PmId
[10894743] Identification, evolution, and essentiality of the mevalonate pathway for isopentenyl diphosphate biosynthesis in gram-positive cocci. (J Bacteriol. , 2000)
[12107122] Enterococcus faecalis 3-hydroxy-3-methylglutaryl coenzyme A synthase, an enzyme of isopentenyl diphosphate biosynthesis. (J Bacteriol. , 2002)

close this sectionSequence

selected fasta
>putative 3-hydroxy-3-methylglutaryl-ACP synthase [HMG-CoA synthase-like protein]
MKPVGIEAINVYCGETYVDVPTLFAARQLDDSRIDNLMMARKSVALHCEDAVSFAVNAAK
PIVDALSEEERGRIELLIVGTESGVDFGKSLATYVHDHLGLPRSCRLFETKQACYSGTAA
TQMAAAVVAASPFDGAKALVISSDVARPVPHTYVEPSQGAGAVAMLISDQPVVASFDRGA
NGFHSYEVMDTCRPDPEAEAGDVDLSLLTYIDCLKSSFTDYARKVEGADLVDSFDLLAMH
TPFPGMVKGAHRAVLRKLKRMSPQAVEDDFAARLSAAVEYPRQVGNIYAGTVFLALASTI
DNAVIDRERRVGIFSYGSGCSSEFYSAVVTPESQRAVRAMGIRQALDDRYELSVPEYDEL
LTATAELKFGARDFTFDLDRFPQITKARFGGGTSRPRLVLEAVRNYHREYVWLGDGR
selected fasta
>putative 3-hydroxy-3-methylglutaryl-ACP synthase [HMG-CoA synthase-like protein]
ATGAAGCCGGTCGGCATCGAAGCCATCAACGTCTACTGCGGAGAGACCTACGTCGACGTA
CCCACCCTGTTCGCGGCCCGGCAGCTCGACGACAGCCGCATCGACAACCTGATGATGGCC
CGCAAGAGCGTCGCCCTGCACTGCGAGGACGCCGTCTCCTTCGCGGTCAACGCCGCCAAG
CCCATCGTGGACGCGCTGTCCGAGGAGGAGCGCGGCCGCATCGAGCTCCTGATCGTCGGC
ACGGAGTCCGGCGTCGACTTCGGCAAGTCCCTCGCCACCTACGTCCACGACCACCTCGGA
CTGCCCCGCTCCTGCCGCCTGTTCGAGACCAAGCAGGCCTGCTACAGCGGCACGGCGGCG
ACACAGATGGCCGCGGCCGTGGTCGCCGCCAGCCCGTTCGACGGCGCCAAGGCCCTGGTG
ATCAGCAGCGACGTCGCCCGTCCCGTGCCGCACACCTACGTCGAGCCGAGCCAGGGCGCC
GGCGCGGTCGCCATGCTGATCAGCGACCAGCCGGTCGTCGCCTCCTTCGACCGGGGCGCC
AACGGCTTCCACAGCTACGAGGTGATGGACACCTGCCGCCCCGACCCGGAGGCGGAGGCC
GGCGACGTCGACCTGTCGCTGCTCACCTACATCGACTGCCTCAAGAGCTCCTTCACCGAC
TACGCGCGCAAGGTCGAGGGCGCGGACCTCGTGGACAGCTTCGACCTGCTGGCCATGCAC
ACGCCGTTCCCCGGCATGGTCAAGGGCGCGCACCGGGCCGTCCTGCGCAAGCTCAAGCGG
ATGTCCCCGCAGGCCGTCGAGGACGACTTCGCCGCCCGTCTGTCCGCGGCGGTCGAGTAC
CCGCGCCAGGTCGGCAACATCTACGCGGGCACCGTCTTCCTGGCGCTGGCCAGCACCATC
GACAACGCCGTCATCGACCGGGAGCGCCGGGTCGGGATCTTCTCCTACGGCTCCGGGTGC
AGTTCCGAGTTCTACAGCGCCGTCGTCACCCCCGAGTCGCAGCGCGCGGTCCGCGCCATG
GGCATCCGCCAGGCCCTGGACGACCGCTACGAGCTGTCCGTGCCGGAGTACGACGAGCTG
CTCACCGCCACCGCCGAGCTGAAGTTCGGCGCCCGCGACTTCACCTTCGACCTGGACCGC
TTCCCGCAGATCACCAAGGCCCGCTTCGGTGGCGGCACGAGCCGCCCCCGACTGGTCCTG
GAGGCCGTCCGCAACTACCACCGCGAGTACGTCTGGCTGGGGGACGGCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013528 Hydroxymethylglutaryl-coenzyme A synthase, N-terminal (Domain)
 [2-168]  3e-14 PF01154
PF01154   HMG_CoA_synt_N
IPR013746 Hydroxymethylglutaryl-coenzyme A synthase C-terminal (Domain)
 [256-374]  5.40000000000001e-14 PF08540
PF08540   HMG_CoA_synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [45-165]  1.3e-17 G3DSA:3.40.47.10 [166-322]  5.8e-08 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [3-171]  3.19999899046351e-33 SSF53901 [174-414]  3.70001063537244e-57 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit