close all open/close all

CDS information : Virg_00240


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction65,145 / 63,805 / - [in whole cluster]
36,769 / 35,429 / - [in contig]
Locationcomplement(63805..65145) [in whole cluster]
complement(35429..36769) [in contig]
TypeCDS
Length1,341 bp (446 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative decarboxylase
Product (GenBank)alpha-ketoacyl-acyl carrier protein
Gene
Gene (GenBank)virB
EC number
Keyword
  • virginiamycin M
  • C-12 methylation
Note
Note (GenBank)
Reference
ACC
PmId
[17350183] Characterization of biosynthetic gene cluster for the production of virginiamycin M, a streptogramin type A antibiotic, in Streptomyces virginiae. (Gene. , 2007)
Related Reference
ACC
P40804
PmId
[16757561] Convergence of isoprene and polyketide biosynthetic machinery: isoprenyl-S-carrier proteins in the pksX pathway of Bacillus subtilis. (Proc Natl Acad Sci U S A. , 2006)
ACC
Q8VMT6
PmId
[11583847] An unusual beta-ketoacyl:acyl carrier protein synthase and acyltransferase motifs in TaK, a putative protein required for biosynthesis of the antibiotic TA in Myxococcus xanthus. (FEMS Microbiol Lett. , 2001)

close this sectionSequence

selected fasta
>putative decarboxylase [alpha-ketoacyl-acyl carrier protein]
MSDDAPEAPAQPVAVTAAAVLSPLGDRLDGFTANLLAGHSAVRMPSGDGTADGGPLPVAA
LDDFVLAAWAERHLAGNGETAALLRRVAGRAAMPARTAACVALRAVLDAGLEPGGAWGEE
TALLVAGSNLALAHQAATVLGHHSSPGRLRASYALTHLDVDVVGTVSEVTGVRGEGWTVG
GASASGTIALIQGARMVASGWARRVLVVAPAAELSPVEAEAFRRTGAMAHEALRGTPERM
CRPFDRARQGFVRGEAAAAVVLESAAAARSRGTEVLAEIAGHGQRLDARRGTEPDARGQA
AAMRAALRSAGLTAQDVDYVNAHGTGSVLGDEVEAASLREVFGERPSLRINSTKPLTGHC
LSAAGLVEAVAVIGQLRAGSVHPNPNLEHPVDPGLPLAGTRAERHPMRTALSNSFAFGGV
NASVVLRLPGTARAAAAPIHPNPDHT
selected fasta
>putative decarboxylase [alpha-ketoacyl-acyl carrier protein]
GTGAGCGACGACGCGCCCGAGGCCCCGGCGCAGCCGGTGGCGGTCACCGCGGCGGCCGTT
CTCAGTCCGCTCGGTGACCGGCTGGACGGCTTCACCGCCAACCTCCTGGCCGGACACAGT
GCGGTGCGGATGCCGTCCGGGGACGGCACCGCGGACGGCGGCCCCCTGCCCGTCGCGGCG
CTCGACGACTTCGTCCTCGCAGCGTGGGCCGAGCGCCACCTCGCCGGCAACGGCGAGACC
GCCGCCCTGCTGCGGCGGGTCGCCGGCCGGGCCGCGATGCCGGCGAGGACCGCGGCCTGC
GTGGCGCTGCGGGCCGTGCTGGATGCCGGCCTCGAACCCGGCGGCGCGTGGGGCGAGGAG
ACCGCACTGCTGGTCGCGGGCAGCAACCTCGCCCTCGCCCACCAGGCCGCCACCGTGCTC
GGCCACCACAGCTCGCCGGGACGGCTGCGGGCCTCGTACGCGCTGACCCACCTCGACGTG
GACGTGGTCGGCACCGTCAGCGAGGTCACCGGCGTCCGCGGCGAGGGCTGGACGGTGGGC
GGCGCGTCCGCCAGCGGCACGATCGCACTGATCCAGGGCGCCCGGATGGTCGCCTCGGGA
TGGGCGCGCCGGGTCCTGGTGGTGGCGCCGGCCGCCGAGCTGTCCCCGGTCGAGGCGGAG
GCGTTCCGCCGGACCGGGGCCATGGCCCACGAGGCGCTGCGCGGTACGCCGGAACGGATG
TGCCGGCCGTTCGACCGCGCCCGCCAGGGGTTCGTCCGGGGCGAGGCCGCCGCGGCGGTG
GTCCTGGAGTCCGCGGCCGCCGCACGGTCCCGCGGCACCGAGGTGCTCGCCGAGATCGCC
GGTCACGGCCAGCGGCTGGACGCACGCCGGGGCACCGAGCCGGACGCCCGGGGCCAGGCC
GCGGCGATGCGGGCGGCGCTCCGCTCGGCCGGCCTGACCGCGCAGGACGTCGACTACGTC
AACGCGCACGGCACCGGTTCGGTCCTCGGCGACGAGGTGGAGGCCGCGTCGCTGCGCGAG
GTGTTCGGCGAGCGCCCCTCGCTGCGGATCAACTCCACCAAACCGCTGACCGGGCACTGC
CTGAGCGCCGCCGGGCTGGTCGAGGCCGTCGCCGTCATCGGCCAGCTGCGGGCCGGCAGC
GTCCACCCCAATCCCAACCTGGAACACCCGGTGGACCCCGGACTGCCGCTGGCCGGCACC
CGCGCCGAACGCCACCCGATGCGCACCGCCCTCAGCAACAGCTTCGCGTTCGGCGGCGTC
AACGCCTCCGTCGTCCTGCGCCTGCCGGGCACCGCGCGCGCCGCGGCCGCGCCCATCCAC
CCGAACCCTGACCACACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [11-267]  2.80000000000001e-18 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [276-387]  8.70000000000003e-31 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [9-281]  1.2e-28 G3DSA:3.40.47.10 [291-427]  1.99999999999999e-45 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [10-273]  2.19999900980708e-31 SSF53901 [236-429]  8.69997440322062e-57 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit