close all open/close all

CDS information : Virg_00250


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction86,338 / 65,444 / - [in whole cluster]
57,962 / 37,068 / - [in contig]
Locationcomplement(65444..86338) [in whole cluster]
complement(37068..57962) [in contig]
TypeCDS
Length20,895 bp (6,964 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.3 PKS/NRPS hybrid
Productpolyketide synthase/non-ribosomal peptide synthetase
Product (GenBank)hybrid polyketide synthase-non ribosomal peptide synthetase
Gene
Gene (GenBank)virA
EC number
Keyword
  • virginiamycin M
Note
Note (GenBank)
Reference
ACC
PmId
[17350183] Characterization of biosynthetic gene cluster for the production of virginiamycin M, a streptogramin type A antibiotic, in Streptomyces virginiae. (Gene. , 2007)
[17375285] Identification of the bkdAB gene cluster, a plausible source of the starter-unit for virginiamycin M production in Streptomyces virginiae. (Arch Microbiol. , 2007)
[26982529] Characterization of Intersubunit Communication in the Virginiamycin trans-Acyl Transferase Polyketide Synthase. (J Am Chem Soc. , 2016)

close this sectionPKS/NRPS Module

M1
2
3 glycine
4
5
KS17..390
dh613..752
KR1090..1270
MT1487..1588
ACP1691..1759
ACP1801..1871
KS1929..2306
DH2517..2687
KR3064..3249
ACP3351..3419
C3474..3750
A3918..4313
PCP4422..4480
KS4553..4878
DH5108..5258
KR5605..5783
ACP5878..5946
KS6003..6384
ACP6734..6807
ACP6835..6908

close this sectionSequence

selected fasta
>polyketide synthase/non-ribosomal peptide synthetase [hybrid polyketide synthase-non ribosomal peptide synthetase]
MAVPDARGPAEEDVRGAVAVIGMACRVPGADDVDAFWSLLAEGHCRIEPVPAGRFAGSPA
GDPAAAAPRAGLLDRIDLFDARFFSVTPRQAASMDPQQRALLELSWHALEHAALDPDDLA
GTPVGVFAAACSYDYREQLVERDAADGYATVGTFPAFLANRISHTYDFTGPSITVDTACS
GALTALSLAERAIRSGDCEIALAGAANLLSNGFNNEAYRRAGMLSPQGTSLVFDRGADGF
VRGEGAGWVVLKRLDRAIEDGDPVLAVLRATAVNHGGRAAALTAPNPRAQAALVRTALDR
AGLHAADLGFLEAHGTATPLGDPIEIDAVREVLEGGAGGPVTRAAGPLDRLWVGSAKANI
GHLEGASGLAGLIKAVQVLRNELIPGTPNFTELNPHIDLDGTPLTVADHPVRWPRVDGSP
RRAAVSAFGFGGSNAHAVLEEAPALDGPGAANGNGVLLAVPLSAATARSLVRLAGRLADR
IGKEPSGLDLQQIAWSLQSGRRALAERMLVVARDTGELADAVRAFAAGETHPATATLERP
DALATLTDERARTALLQWLSGGTADWAALWTVGQPPRRVPLVPYPFEREPYWLPGEPAAR
PASAVAAPSGPAPTAVVATAAAVTGGRTNALVLPAGHPLAEHRVAGRAVAPGALLIDALA
GGGPVALSGVRFLRPVPFDDGLRLERGTDDGHGRTALTVHHDGHVHARAVADPGTPEPLA
AGDRTLADGTPVDLADMLHRAGIDVGTAYHAVTALVRSGNRAAGRLTPPAGDPLTRRVGW
LDAALQAACALAAPGSTLMAAALGRVFWSGELPDRADLLLHLVEDSPEHVLVDLDAVTED
GRAVLRVRGLRLVQAPSAPASTAPAQAAQDSAPIRVLSPVWAEESTPRPAPAGTATHTVT
LYDRHTERAAEGLRGDVATLLPVGPDGVDRDRLGTAVRAAAGSPLAVTLLVGGCRWTEDT
AGVTALRHWLTALLTTAQVLAESGTPAEVRLLTTGLGAPDGESPAPGASLQGALLGALRT
LPLEVPTVTAAAVDLPADALHSAAFEPIAAAVAEPCGRAVPLVALRGVRRLRQVLAERPL
PDARGFRPGGVYVVFGGAGGIGGEVARHLAARYRASLLLVGRSAEGEDVRNLLEDLRAAG
GQAHYHRGDVTDAGDVAAALARCRTDFGEPDGLLHSVGSVSDGLLTGLTAADIDHVLETK
VTAVLTLRRALAGRPGTALVLFSSVAGLFGSVGGLNYAAANAFLDHYAAAVDGDGGLVVR
TFDWGLWRGTGLARQYTAHVRRQYPGLTDFEPERGVAALEAGMSGTDPQTVAISGDPEPL
RALTRPAAADPAHLLERYARGALARTMADLGLDHGTARAGCTAAADLLGVVPEHHRLLAA
VLDLLEGEGPDARSAVHLATDRAALLAGHPDLLGHVELLDRALASYGPVLRGEQPATAVL
FPRGDLGAVSAIYSNNQLFDPVNAAVARELAADAARIAREGRRPRILEIGAGVGGTTASA
LAAMDALGVTDAEYAYTDVSRAFLQHARRRFGERVGPQLLDIEKSPAGQGFATGHYDLVV
ASNVLHATRDLTLVLRHVSELLAPGGRLLLVEITVPAAVYTLTFGLTDGWWRYVDTQYRL
PHGPLLDGARWQALLEAGGWTLAGVGHQRDVPGCVALLDCRAPSAPAADVPAAAAATRTP
AADGTDGTGGTHDRLREIVRELLGDPRADVPGDRPWQELGIDSLLNLELVTAVSKAFGEI
SSTALFEHRTLDELARALGGRARPAGATAAATAFAAAEAPDEAPAAGDGDATGDGAGAAD
LLAELTGLAADLTGQDHALIDQDCDFPGIGVDSLLNGEFTAALRQRFPARAIPSTVLFEH
TSLRSLAAWLAAPTRRARPHAVTVAAATPPAPLTVPATLPVSPDAAARSAAGPRPARPAV
PAEPSGHRAPVAIVGLAGRYPGAEDIDAFWRLLSEGRNPVTEVPAERWDWRTARTLGGGY
ARWGCFVDGWDRFDPELFRITPRDAAVMDPQERLFLEVSWEAFETAGYSRRTLSGSAGGP
KVGVFAGVTSNSHLIAQHQARLAGADNPEYAVTAAASVANRVSHAFDLSGPSLTVDTMCS
SSLTALHLACRAVQDGEADLALAGGVNLYLHPDRFAGLCALGMQAWRTSRGDRTRAFGAG
GDGFVPGEGVGAVVLKRLDRAEADGDTVYAVIRGTGLNHGGGTGGYTVPNPLAQAAVIGT
TLDAAGIDPAAVGYLEAHGTGTELGDPIELRALALAFDGDRPATAGLRIGSVKSNIGHGE
AAAGIAGLTKAVLQLRHGQLVPTLHAEQLNPKLDLDGTSLHIQRRAEAWPQSVDAEGRTL
PRLAAVSSFGAGGSNAHVLLEEYPQTAQPAPARPGADRTPVLLPLSAPDPQRLRTLAARL
AGLIAHVPGSETLLAATATPTDIAHTLRVGRETWPHRAAVTASDPRRLREALTALAEGRP
HPDVATADTADHAEAVARAWVVDGRPPAQDLPGRRVALPTTPFARRRCTLTAPEGHDPLL
GAPIDLPLADSVRIPATRTVTARLGGASRWVADHVVDGTALLPGAFHPELVHEALLTAGE
SPYRQVIRDLMWPAPAAGLPMTVRAELAEPGADGTRSFTVEAVTAADGERTAARGWTEAA
VADRVQPSLRYRPEDLARHLAEGVDAEDFYRVFAGHGFAYGPLYRTVRRALRDGEETTAR
LRLPDGEDRDGRQVLHPALFDGACQTAAFLLLCEDPAARRRYRPLSVNRLAVHAPVTGEA
YVHARRVRAEEASGTHVFDVRLVDAGSGEVLAEAEGFRIRVEDRDAPAAPARTADTATTA
AAFAPADGDRAPAVATYRLGWPDAPRPAAGRPIGTLWTVGDGALADGLAPQAAARLSFDR
ACDVDALAETAGRTGAPATVLVDLTGGPRGLGFGAEPLPAGQIAADWTDFRTGPIAQVFG
LLQALVRSRALDGVLVLFATDDSATGPSPFQRALHSLVRTVAGETGRLRLRMASVGSGTA
GTVLPDADADADAVAAVRAELSAEPADGEDWVRIGPGDRRRRAALAPVRDTGTADPAGLL
RADGTYLVIGGQGGLGSEIAAAVRAARPTARLVLVGRSAPDEAALAQLRGPAGTGPVDYR
RCDVTDLAQLAELAAELQRSGTELHGIVHTAGVLRDGFLRGKTPEMIEEVCRAKVLAAVA
VDAAFHDHPLDFFVVASSLAALVGNQGQSDYAFANGFLDGFAAARTRWTELGLRSGRSLS
VGWPVLEGAGMAPEPAALGYLSDTFGLRPLPVREAVRRMWPLLDLATGPWQAHAALVAGD
QDLWSRALGVAADAAADTPEPREAPAAPTPAVADAAAAADPAPAADGRTAALRWLAERVG
RAIGVPAAMIAADRPLLDYGVDSIAVMRLSRLLEDDLGRLPVALLLDSSTLGELTDRLLR
DHGAQLTAAVSAETGPAPAEAPAAPAAPAVIGAAPAPVDAAGTEAVPLPDRLIGMWTSDQ
AAAPLAPYNISLSWRLADADRAALAGAVDDLVRRHPVLGCCVRPHRGEPSFVPARTAPAL
VDRSPEVGMDLATAVRQEADRRFAPATEPLLRPVLWRDGTDTVVQLTTHHLAADGRSAEL
IGQDLAALYAARTGGGTALAPAPSFADVLRREREDAARTRAADESFWAARLARLTAGPLF
PDADTGTDAASAQREYGLGADLSALLSATARTAGVTPFTVLLAAFAASLGRLTGRRSFLL
AVPAYGRASASEDDAVGCFVNSVPLRIDLDPARPVADWLTSLHDEVRGAVGHAGLPYPRL
TELCRAAGEHTVPTVTFAYQNWRRDTAGAAPGGRTDIGLPVHRRGQRGHFDLGLEVTDGP
DGMDVLANHRTGALDGPAVDGLVEDLRRMVVELSRDLDGGRTGRLLDPAGSTLVSRFADS
VRRTPDRTAVEDRDDTFSYAALDELSDAVARQVSRATGPGEPVAVLMHRSARLAAVLLGI
LKSGRPYVPLDDSYPADRLRMVVEGAECRLAVADPDLAALLPATLRVLPAAQALDPAAAP
EPDSGRGTAPLPGDLAYLMFTSGSTGRPKGVGVTHGNVVHTLEAIAATTGTGPQDRLLAV
TTVCFDISVLELFMPLLTGGTVVVARRTDVVDARRLADLIESRNVTVLQATPAGWQLLLD
GGWRGRAGLTALCGGEALPPNLAAGLVSRTGSLWNVYGPTEATIWSTIGRVDGAAVHLGG
PIGATDLVVTEVDGTAAPAAGEPGELWIGGPGVAQGYWRRPDLTAERFTAHPARPEGGGR
WFRTGDLVRRDEQGRLVFLGRADSQVKIRGHRVELGEIEAVLGTHPGLARVVVVLRGEGA
LVRLVAVAVPARGAAAPGLDELRAFAAASLPAWMLPDRLVTTPELALTPNGKVDRKAAAL
LARPAAEREAATDPVRSADPAPAPVPMPPAVHAPAQADPARIRQSVTSFWAELLELDHVP
GDRRFFDLGGNSLLLGRLFARLEDRFPGTGLEVADLFARPPSTTRWPCSPSGSPRPHPPP
RPPRPPRRPDRAAPFRSRCPPVPPRGTARPSTRRRPPMNHDHHPYDAVDDPNAVAVVGMS
CRFGPATSADRLWELLEQGRSGIHRYSPEELVRLGHRPELVRRPGFVPAGVVMEDADAFN
NEFFGYSPVHAEWLDPQQRVLLETAWHALEDAGFAPDRTGLRTAAYVSVGQSTMPQVGIT
DLDAAGMIRFSSSDKDFAASRISYKLGLTGPSLTVQSACSSGLVAVHLAVESLLGEESDL
AVVGAASLHFPQAGYLAAPDMILSPSGECRPFDDGADGTVFGNGAGALVLRRLADAVRDG
DPIRAVIRGSAVNNDGARKMDYHAPSPEGQEAVLREALAVAGIDAHTVGYLETHGTGTHL
GDPIEYAALDRVYGGERPHPPPSAPSRASSATSTPRPDSPAWPRLILALEHAAVPPQAPF
EKPNRRLAGTGGLRIAAGGDGWPVPDGPRRAAVSSFGIGGTNAHVVLEQAPDLPAPPAGN
GHDEHRVPVSARTEEALRQLAASLADSLGRPGAPEPADVAHTLSTGRSHRAVRAVLTART
TAELAEQLRTLAREGTAAAATSAAPYRAWIEGTGELPEPEPAAGRTGRRVRLPGYPFARR
RWPRPDAPDLAPDNRSPEAATDALPVRTVRPGDPLAADHLVGGLPVFPAAAQIDLALTAA
GRLAGGPAAGLADLAFRRTVEVVDPVELRVEIEDGQVRVASTDVHSQARLLPAGAPERPA
PLDLAALRRSYPESAEPEALYRYFADNGVGYGPAFRVLRELHHGPAGVLARVTAAPESVP
GETVSPCVLDGALQSVIGCVLREDLAGETFIPFAIDELTVHAPLPGEVWVTVSPQRLAGG
GRRVRRYDVAVAAEDGAVLLTLRGLALRPVTAPAAAGAPAVPQGVHLFASTAEEFAPTGR
DAATAGPLVLIGDTALDGADLVLPAPADPDAAAAAGAELAARLPAGGGRPTIVWPAAADD
PHTDPAATATDGALRVLALLRALLRPLGRRGAHLVVPYPAGSPAGAVAGAGLAALGRSLT
GENPRFDLTALAVEDGAGPAGLRRALDALTVRVPLSRALTVAADGGLRTTVLAPLTPAPR
RALLDPRDGRPSTLQACKLGIGIHGMGRLAALLAEHLLDRHAARIVLTGRSAADGARGEE
LRRLADRAARTGGSVEYRQLDPSDPAAVGDTARRIAADGPAVNGVFHCAGVLRDGYVLRK
TVADARDVIVPKLVGAAELDSATADWDLDCFVVLSSVSGALGSAGQADYAFANAAADELV
RRRADRAGRGRSVSIAWPFWADGGMRPDGPAQEELATLGMRALPTEAGLAVLESLLAGPA
TAPVVLYGDREALLASFPLLTSEAPAAVPEPAPAQAPAPAAEQAAPAAAPAGEVTAVLHR
RLAAVVAEATRTPVDDVTADRLFDDLGIDSLLAIRVVELLEKDFGRLSKTLLFECRSVEE
LAEYLREEHPERCAALAGGPKETTAPAAPAAQAPAPAAPAQAPAPAVSAMPSGPSDDDLA
DPRAIAVIGVAGRFPEADGLDRLWRNLTEGRDSITEVPADRWDAEALYDADKTRVDRTHT
KWGGFVDGVENFDAALFNISPREAGIVDPQARLFLESCWAALDDAGYTPDRLVSAAEDPV
HRRDVGVFVGAMYGEYQLHEAEERLRGNPVLANSAYWSIANRVSYFFDFQGPSVAVDTAC
SSALTAVHLAVESLRAGTSRVAIAGGVNVLIHPNKYFMLGQGRFASSDGRCRSFGAGGDG
YVPGEGVGAVLLKPLRDALRDGDHIHAVIRGTAANHGGRTNGYTVPNPRAQADLVTKALR
DAGLTARDLDYIEAHGTGTALGDPIEIRGLASAFARDGIKGPGSLPIGSVKSNVGHLESA
AGSVALAKVLLQLRHRTLVPSLHATPPNPEIDFDGVPFSVQQQLAPWRTHDGAARPLRAG
ISSFGAGGGNAHLIVEEAPAPAPRPATGRREPQVLFLSARTDTALAAYARDLRDHLLRAR
SAGEEPSAADVAFTFAVGRVDLARRAVLPADSLDLLLAGLEALAEGRPRPVPPAGEEIAA
WLSGRRIDREAACGAASVGRRIPLPHYPFERVRCWYDLQIAHLHRQGLGSAGQEPAFARD
HLRDFGRAPSDRPQAMPGTAPAPAAVPVSAAEGAQVSAPTGVPARAAVRPAVPAPTAVPT
LTLRGAAEPARRPATDPMEKPQMTSDRKISLRPLAPATAATRPAAPATPATPAAPAAVPA
PPAAPAPAAVPAGRQEEIAEEVARLLAGVLYLEPDRLDPEETFLTLGVDSILGVEFVAAV
NAAYPVGVKATALYDHPTPAAFARHIAESLGAPAPAPTFAPAVPASPAVPAVAVDPAPVA
RALREELARTLYCEPGDIDDEASFNTLGLDSILGVEFVAFVNQTYGLDEKAGILYDHPSL
AALSRHVAGRAAPVPAAAAEPAALPLPVTGAGEPSQADLDALLSAVRDNRLSIEQAVTLL
TPRR
selected fasta
>polyketide synthase/non-ribosomal peptide synthetase [hybrid polyketide synthase-non ribosomal peptide synthetase]
GTGGCCGTTCCGGATGCCCGCGGGCCGGCTGAGGAAGACGTACGGGGCGCCGTCGCCGTC
ATCGGCATGGCCTGCCGTGTCCCCGGCGCCGACGACGTGGACGCGTTCTGGTCCCTGCTG
GCCGAGGGCCACTGCCGGATCGAGCCGGTTCCCGCGGGTCGTTTTGCCGGGTCCCCGGCC
GGCGACCCGGCCGCCGCCGCGCCGCGGGCCGGGCTGCTGGACCGGATCGACCTCTTCGAC
GCCCGCTTCTTCTCCGTCACCCCGCGCCAGGCCGCCTCGATGGACCCGCAGCAGCGCGCG
CTGCTCGAACTGAGCTGGCACGCCCTGGAACACGCGGCCCTCGACCCGGACGACCTGGCG
GGCACGCCGGTCGGCGTGTTCGCCGCCGCGTGCAGCTACGACTACCGCGAGCAGCTGGTG
GAGCGGGACGCCGCCGACGGGTACGCCACCGTCGGCACCTTCCCCGCCTTCCTCGCCAAC
CGGATCTCCCACACCTACGACTTCACCGGCCCGAGCATCACCGTCGACACCGCCTGCTCC
GGCGCGCTCACCGCGCTCTCGCTCGCCGAGCGGGCGATCCGCTCCGGAGACTGCGAGATC
GCCCTAGCGGGCGCCGCCAACCTGCTGAGCAACGGCTTCAACAACGAGGCGTACCGCCGG
GCCGGCATGCTCTCCCCGCAGGGGACCAGTCTGGTGTTCGACCGAGGAGCCGACGGGTTC
GTCCGCGGCGAGGGCGCCGGCTGGGTGGTGCTCAAGCGGCTCGACCGGGCGATCGAGGAC
GGCGACCCGGTGCTGGCCGTCCTGCGGGCGACCGCCGTCAACCATGGCGGTCGCGCCGCC
GCCCTGACCGCCCCCAACCCCCGCGCGCAGGCCGCCCTGGTGCGCACCGCCCTGGACCGG
GCCGGTCTGCACGCCGCAGACCTGGGCTTCCTGGAGGCTCACGGCACCGCCACCCCGCTC
GGCGACCCGATCGAGATCGACGCCGTCCGGGAGGTGCTGGAGGGTGGCGCCGGGGGACCG
GTCACCCGGGCCGCCGGCCCGCTGGACCGGCTGTGGGTCGGCTCGGCCAAGGCGAACATC
GGGCACCTGGAGGGCGCGTCCGGCCTCGCCGGCCTGATCAAGGCCGTCCAGGTGCTGCGC
AACGAGCTGATCCCCGGGACACCGAACTTCACGGAGCTCAACCCGCACATCGACCTCGAC
GGCACCCCGCTCACGGTGGCCGACCACCCGGTCCGCTGGCCGCGGGTGGACGGCTCCCCG
CGTCGAGCCGCCGTCAGCGCCTTCGGTTTCGGCGGCAGCAACGCGCACGCCGTCCTGGAG
GAGGCCCCGGCCCTCGACGGCCCGGGCGCGGCGAACGGGAACGGCGTACTGCTGGCCGTC
CCCCTGTCGGCCGCCACCGCGCGGTCGCTCGTCCGGTTGGCCGGCCGCCTCGCCGACCGG
ATAGGGAAGGAACCGTCCGGCCTCGACCTGCAGCAGATCGCCTGGTCCCTGCAGAGCGGC
CGGCGCGCCCTGGCCGAGCGGATGCTGGTCGTCGCCCGCGACACCGGCGAACTGGCCGAC
GCCGTGCGGGCGTTCGCCGCGGGGGAGACCCACCCGGCGACCGCCACCCTCGAACGCCCC
GACGCCCTCGCCACCCTGACCGACGAACGGGCCCGCACCGCCCTGCTCCAGTGGCTCTCC
GGCGGCACCGCCGACTGGGCGGCCCTGTGGACCGTCGGGCAGCCGCCCCGGCGCGTCCCG
CTGGTGCCCTACCCGTTCGAGCGCGAGCCGTACTGGCTGCCCGGCGAGCCCGCGGCCCGC
CCCGCGTCGGCGGTGGCCGCCCCGTCCGGCCCCGCGCCGACGGCCGTCGTGGCGACCGCT
GCCGCCGTGACCGGCGGTCGCACGAACGCACTCGTGCTGCCCGCCGGCCACCCGCTGGCC
GAGCACCGCGTGGCCGGCCGGGCCGTCGCCCCCGGCGCACTGCTGATCGACGCTCTCGCC
GGCGGCGGACCCGTCGCCCTGAGCGGCGTCCGCTTCCTGCGCCCCGTCCCGTTCGACGAC
GGCCTGCGCCTGGAACGCGGCACGGACGACGGCCACGGCCGGACGGCCCTCACGGTCCAC
CACGACGGCCACGTCCACGCCAGGGCCGTCGCCGACCCGGGGACCCCGGAGCCGTTGGCG
GCCGGCGACCGCACCCTTGCCGACGGCACCCCGGTCGACCTCGCCGATATGCTGCACCGG
GCCGGCATCGATGTGGGCACCGCCTACCACGCCGTCACCGCCCTGGTGCGGTCCGGCAAC
CGGGCAGCCGGCCGGCTGACCCCGCCGGCCGGCGACCCGCTGACCCGCCGGGTCGGCTGG
CTCGACGCCGCCCTGCAGGCAGCCTGCGCACTGGCCGCCCCCGGCAGCACCCTGATGGCC
GCCGCCCTCGGCCGGGTGTTCTGGAGCGGCGAACTGCCCGACCGCGCGGACCTGCTGCTG
CACCTCGTGGAGGATTCCCCCGAACACGTCCTGGTGGACCTGGACGCCGTCACCGAGGAC
GGACGGGCCGTCCTGCGGGTACGCGGCCTCCGCCTGGTTCAGGCACCGTCCGCACCCGCG
TCGACCGCACCCGCACAGGCCGCGCAGGACAGCGCCCCGATCCGCGTGCTGTCGCCGGTC
TGGGCCGAGGAGAGCACCCCCCGCCCCGCCCCGGCCGGCACCGCGACCCATACCGTCACG
CTGTACGACCGGCACACCGAGCGGGCCGCCGAAGGCCTGCGCGGAGACGTCGCGACCCTG
CTCCCGGTCGGCCCGGACGGCGTCGACCGTGACCGCCTCGGCACGGCCGTCCGCGCCGCA
GCCGGATCCCCCCTCGCCGTGACCCTCCTCGTCGGCGGCTGCCGGTGGACGGAGGACACC
GCCGGCGTCACGGCGCTGCGCCACTGGCTCACCGCACTGCTGACGACCGCCCAGGTCCTC
GCGGAAAGCGGCACACCCGCCGAGGTGCGGCTGCTGACCACCGGCCTCGGAGCCCCCGAC
GGCGAGTCCCCGGCCCCCGGCGCCTCGCTCCAGGGCGCGCTCCTCGGAGCGCTGCGCACC
CTGCCACTGGAGGTGCCGACCGTCACCGCCGCCGCCGTCGACCTGCCCGCCGACGCGCTG
CACAGCGCCGCCTTCGAACCGATCGCCGCCGCCGTGGCCGAGCCCTGCGGGCGGGCCGTC
CCACTGGTCGCGCTGCGCGGCGTCCGCCGCTTGCGCCAGGTGCTCGCCGAGCGGCCGCTG
CCCGACGCCCGGGGATTTCGCCCCGGAGGGGTGTACGTCGTGTTCGGCGGCGCCGGAGGA
ATCGGCGGCGAGGTCGCCCGCCATCTCGCCGCCCGCTACCGCGCCTCGCTGCTGCTCGTC
GGCCGCTCGGCCGAGGGCGAGGACGTCCGGAACCTGCTGGAGGACCTGCGGGCAGCCGGC
GGGCAGGCCCACTACCACCGCGGCGACGTCACCGACGCCGGCGATGTCGCCGCCGCACTC
GCCCGCTGCCGCACCGACTTCGGCGAGCCCGACGGCCTGCTGCACAGCGTCGGCTCCGTG
AGCGACGGCCTGCTGACCGGGCTCACCGCCGCCGACATCGACCACGTGCTCGAAACCAAG
GTCACGGCCGTCCTGACGCTGCGCCGAGCCCTGGCGGGCCGGCCGGGCACCGCCCTGGTC
CTGTTCTCCTCCGTCGCCGGCCTGTTCGGCAGCGTCGGCGGCCTCAACTACGCGGCGGCC
AACGCCTTCCTCGACCACTACGCGGCCGCCGTCGACGGCGACGGCGGGCTGGTGGTCCGC
ACCTTCGACTGGGGCCTGTGGCGCGGTACCGGCCTCGCCCGCCAGTACACCGCACACGTC
CGGCGCCAGTACCCGGGACTGACCGACTTCGAACCAGAGAGAGGGGTGGCCGCCTTGGAA
GCGGGCATGTCCGGCACCGATCCGCAGACCGTCGCCATCAGTGGCGATCCGGAGCCGCTG
CGGGCCCTGACCCGTCCGGCCGCCGCCGACCCGGCGCACCTGCTGGAGCGCTACGCACGC
GGCGCCCTGGCCCGGACCATGGCCGACCTCGGCCTGGACCACGGCACCGCCCGGGCGGGC
TGCACCGCCGCCGCCGACCTGCTGGGCGTCGTCCCCGAGCACCACCGCCTCCTCGCCGCC
GTCCTGGACCTGCTGGAGGGCGAGGGCCCCGACGCCCGGTCAGCCGTGCACCTGGCCACC
GACCGTGCCGCCCTGCTGGCCGGCCACCCCGACCTGCTCGGTCACGTCGAACTGCTGGAC
CGCGCCCTCGCCTCGTACGGCCCGGTGCTGCGGGGCGAGCAGCCCGCCACCGCGGTGCTC
TTCCCGCGCGGCGACCTCGGCGCGGTGTCCGCCATCTACAGCAACAACCAGCTCTTCGAC
CCGGTCAACGCGGCCGTTGCCCGCGAGCTCGCCGCCGACGCCGCCCGGATCGCCCGCGAG
GGCCGGCGCCCCCGCATCCTGGAGATCGGTGCGGGCGTGGGCGGCACCACCGCCTCCGCG
CTGGCCGCGATGGACGCCCTCGGCGTCACCGACGCCGAGTACGCCTACACCGACGTGTCC
CGCGCGTTCCTCCAGCACGCCCGGCGCCGGTTCGGCGAGCGGGTCGGCCCGCAGCTGCTC
GACATCGAGAAGAGCCCCGCCGGTCAGGGGTTCGCCACCGGTCACTACGACCTCGTCGTC
GCCAGCAACGTGCTGCACGCCACCCGCGACCTGACCCTGGTGCTGCGCCACGTGTCCGAG
CTGCTCGCCCCGGGCGGACGGCTGCTGCTCGTCGAGATCACAGTCCCCGCCGCGGTCTAC
ACCCTCACCTTCGGCCTGACGGACGGCTGGTGGCGCTACGTCGACACCCAGTACCGCCTG
CCGCACGGGCCGCTGCTCGACGGCGCCCGCTGGCAGGCCCTCCTGGAGGCCGGTGGCTGG
ACGCTCGCCGGGGTCGGGCACCAGCGCGACGTACCCGGATGTGTGGCGCTGCTGGACTGC
CGTGCCCCGTCCGCCCCCGCCGCAGACGTGCCGGCCGCCGCAGCGGCGACCCGGACCCCG
GCCGCCGACGGCACCGACGGCACGGGCGGCACCCACGACCGGCTTCGGGAGATCGTCCGG
GAGCTGCTGGGCGACCCGCGGGCCGATGTCCCCGGCGACCGGCCGTGGCAGGAGCTGGGC
ATCGACTCGCTGCTCAACCTGGAGCTCGTCACCGCCGTGTCGAAGGCGTTCGGCGAGATC
TCCAGCACCGCGCTGTTCGAGCACCGGACGCTCGACGAACTGGCCCGGGCGCTCGGCGGA
CGGGCCCGCCCGGCCGGCGCCACCGCTGCGGCCACCGCCTTCGCCGCGGCCGAGGCCCCG
GACGAGGCCCCGGCCGCCGGCGACGGTGACGCCACCGGCGACGGCGCGGGCGCCGCGGAC
CTGCTCGCCGAACTGACCGGGCTGGCCGCCGACCTGACCGGCCAGGACCACGCACTCATC
GACCAGGATTGCGACTTCCCCGGCATCGGGGTGGACTCGCTGCTCAACGGCGAGTTCACC
GCCGCCCTGCGGCAGCGCTTCCCTGCCCGGGCGATACCCTCCACGGTGCTGTTCGAGCAC
ACCTCGCTGCGCTCCCTGGCCGCCTGGCTGGCGGCCCCCACGCGCCGGGCCCGCCCGCAC
GCGGTCACGGTGGCGGCCGCGACACCGCCCGCACCCCTCACCGTCCCGGCCACCCTGCCC
GTCTCCCCGGACGCCGCGGCCCGCAGCGCTGCCGGCCCGCGCCCGGCCCGCCCGGCGGTG
CCGGCCGAGCCGAGCGGGCACCGTGCACCGGTCGCCATCGTCGGCCTGGCCGGACGCTAC
CCGGGCGCCGAGGACATCGACGCCTTCTGGCGGCTGCTGTCCGAGGGCCGGAACCCGGTC
ACCGAGGTCCCGGCCGAACGCTGGGACTGGCGCACCGCCCGCACCCTCGGCGGCGGCTAC
GCCCGCTGGGGCTGCTTCGTCGACGGCTGGGACCGCTTCGACCCCGAGCTGTTCCGCATC
ACCCCCCGCGACGCCGCCGTGATGGACCCCCAGGAACGGCTCTTCCTGGAGGTCTCCTGG
GAGGCGTTCGAGACCGCCGGCTACAGCCGCCGCACCCTGTCCGGCAGCGCCGGCGGCCCG
AAGGTCGGCGTCTTCGCAGGCGTCACCTCCAACAGCCACCTGATCGCCCAGCACCAGGCG
CGGCTGGCAGGCGCCGACAACCCGGAGTACGCCGTCACCGCGGCGGCCTCCGTCGCCAAC
CGGGTCTCCCACGCGTTCGACCTCAGCGGCCCGAGCCTGACGGTCGACACCATGTGCTCC
TCCTCCCTGACCGCCCTTCACCTGGCCTGCCGCGCCGTCCAGGACGGTGAGGCGGACCTC
GCACTCGCCGGCGGCGTCAACCTCTATCTGCACCCGGACCGGTTCGCCGGCCTCTGCGCG
CTCGGCATGCAAGCTTGGCGTACCTCGCGCGGCGACCGCACCCGCGCCTTCGGGGCGGGC
GGCGACGGCTTCGTCCCCGGTGAGGGCGTCGGAGCCGTCGTCCTCAAGCGCCTGGACCGG
GCCGAGGCCGACGGCGACACCGTCTACGCAGTGATCCGCGGCACCGGCCTCAACCACGGT
GGCGGCACCGGCGGATACACCGTGCCCAACCCGCTCGCCCAAGCCGCCGTGATCGGCACC
ACCCTCGACGCCGCCGGGATCGACCCCGCCGCAGTCGGCTACCTGGAGGCCCACGGCACC
GGAACCGAACTCGGCGACCCGATCGAACTTCGGGCACTGGCCCTCGCCTTCGACGGCGAC
CGTCCCGCCACGGCCGGCCTGCGGATCGGCTCGGTCAAGTCCAACATCGGACACGGTGAG
GCCGCCGCGGGCATCGCCGGCCTCACCAAGGCCGTCCTCCAACTGCGGCACGGCCAACTC
GTCCCCACCCTGCACGCCGAGCAGCTCAACCCCAAGCTCGACCTGGACGGCACCTCCCTG
CACATCCAGCGCCGCGCCGAGGCCTGGCCGCAGTCCGTCGACGCCGAGGGCCGGACCCTG
CCGCGGCTGGCCGCCGTCAGCTCCTTCGGCGCCGGCGGGAGCAACGCCCACGTCCTGCTG
GAGGAGTACCCGCAGACCGCACAGCCCGCGCCCGCCCGCCCCGGGGCCGACCGCACGCCG
GTGCTCCTCCCGCTGTCGGCCCCCGACCCCCAGCGGTTGCGCACCCTCGCCGCCCGGCTC
GCCGGCCTGATCGCCCACGTTCCCGGCAGCGAGACGCTGCTGGCCGCCACGGCCACGCCG
ACCGACATCGCGCACACCCTGCGGGTGGGCCGCGAGACCTGGCCGCACCGCGCCGCGGTC
ACCGCCTCCGACCCGAGGCGGCTGCGCGAGGCGCTCACCGCCCTCGCCGAGGGCCGCCCC
CACCCGGACGTGGCCACCGCCGACACCGCCGACCACGCCGAGGCCGTCGCCCGGGCCTGG
GTCGTCGACGGACGGCCGCCCGCGCAGGACCTGCCCGGCCGCCGCGTGGCGCTGCCCACC
ACACCGTTCGCCCGCCGCCGCTGCACCCTGACCGCGCCCGAGGGGCACGACCCACTACTG
GGCGCCCCGATCGACCTGCCGCTGGCCGACTCCGTACGGATCCCCGCGACCCGGACGGTG
ACGGCCCGCCTCGGCGGCGCGTCCCGCTGGGTGGCCGATCACGTCGTCGACGGCACCGCG
CTGCTGCCCGGAGCCTTCCACCCCGAACTCGTCCACGAGGCGCTCCTGACCGCCGGCGAG
TCCCCGTACCGTCAGGTCATCCGTGACCTGATGTGGCCCGCCCCCGCCGCCGGGCTCCCC
ATGACGGTCCGTGCCGAGCTGGCCGAACCCGGCGCCGACGGTACGCGCAGCTTCACCGTC
GAGGCGGTCACCGCCGCAGACGGCGAGCGGACCGCGGCACGCGGCTGGACCGAAGCCGCC
GTCGCCGACCGGGTCCAGCCCTCCCTGCGGTACCGGCCGGAGGACCTGGCCCGGCACCTC
GCCGAAGGCGTCGACGCCGAGGACTTCTACCGGGTCTTCGCCGGCCACGGCTTCGCCTAC
GGTCCGCTCTACCGGACCGTGCGCCGTGCGCTGCGCGACGGCGAGGAGACCACCGCCCGG
CTCCGGCTGCCCGACGGCGAGGACCGTGACGGCAGGCAGGTGCTTCACCCGGCGCTGTTC
GACGGCGCCTGCCAGACCGCGGCCTTCCTGCTGCTCTGCGAGGATCCCGCCGCCCGGCGC
CGCTACCGGCCGCTGTCCGTGAACCGGCTCGCCGTGCACGCCCCGGTGACCGGCGAGGCG
TACGTCCACGCGCGCCGGGTCCGCGCCGAGGAGGCGTCCGGCACGCACGTCTTCGACGTG
CGCCTGGTCGACGCCGGCTCCGGCGAGGTGCTCGCCGAGGCCGAGGGCTTCCGCATCAGG
GTGGAGGACCGTGACGCCCCGGCGGCCCCGGCCCGTACCGCCGACACGGCCACCACGGCT
GCCGCGTTCGCTCCGGCGGACGGCGACCGCGCCCCGGCCGTCGCCACCTACCGGCTCGGC
TGGCCGGACGCCCCCCGTCCCGCCGCAGGGCGCCCGATCGGCACCCTCTGGACGGTGGGC
GACGGCGCCCTCGCCGACGGCCTGGCCCCGCAGGCCGCCGCCCGCCTCTCGTTCGACCGG
GCCTGCGACGTCGACGCACTGGCGGAGACCGCCGGGCGCACCGGAGCCCCCGCGACCGTC
CTGGTCGACCTCACCGGCGGCCCGCGCGGCCTGGGGTTCGGCGCCGAACCGCTGCCCGCG
GGGCAGATCGCGGCCGACTGGACGGACTTCAGGACCGGCCCGATCGCACAGGTCTTCGGC
CTGCTCCAGGCCCTGGTCCGCTCCCGCGCCCTGGACGGCGTCCTGGTGCTGTTCGCCACC
GACGACTCCGCCACCGGACCGTCGCCCTTCCAGCGCGCCCTGCACAGCCTGGTGCGCACG
GTGGCCGGTGAGACCGGCAGGCTGCGGCTGCGGATGGCCTCCGTCGGCTCCGGCACGGCC
GGCACCGTACTGCCCGACGCCGACGCCGACGCCGACGCCGTCGCCGCCGTCCGGGCCGAG
CTCTCGGCCGAACCGGCCGACGGCGAGGACTGGGTGCGGATCGGCCCCGGCGACCGCCGC
CGGCGTGCTGCCCTGGCCCCCGTCCGGGACACGGGTACGGCCGACCCGGCCGGCCTCCTT
CGCGCGGACGGAACCTACCTGGTGATCGGCGGGCAGGGCGGCCTGGGCAGCGAGATCGCC
GCCGCCGTCCGGGCCGCCCGGCCGACCGCACGCCTCGTCCTGGTCGGGCGCTCGGCCCCC
GACGAGGCGGCCCTGGCCCAGCTTCGCGGGCCGGCCGGCACCGGACCGGTGGACTACCGC
CGGTGCGACGTCACCGACCTCGCCCAGCTCGCCGAGCTGGCCGCGGAGTTGCAGCGCTCC
GGCACCGAGCTGCACGGCATCGTGCACACGGCCGGCGTCCTGCGGGACGGCTTCCTGCGG
GGCAAGACCCCCGAGATGATCGAGGAGGTCTGCCGGGCCAAGGTGCTGGCCGCGGTCGCG
GTGGACGCCGCCTTCCACGACCACCCGCTGGACTTCTTCGTCGTCGCCTCCTCGCTGGCC
GCCCTGGTCGGCAACCAGGGGCAGTCCGACTACGCCTTCGCCAACGGCTTCCTGGACGGC
TTCGCGGCCGCCCGGACCCGCTGGACGGAACTGGGCCTGCGGTCCGGGCGCAGCCTCTCC
GTGGGCTGGCCGGTGCTGGAGGGCGCCGGCATGGCGCCCGAGCCCGCCGCCCTGGGCTAC
CTGTCCGACACCTTCGGGCTGCGCCCGCTGCCGGTGCGCGAGGCCGTACGCCGGATGTGG
CCGCTGCTCGACCTGGCCACCGGACCCTGGCAGGCGCACGCCGCCCTGGTCGCCGGCGAC
CAGGACCTGTGGTCCCGGGCACTGGGAGTCGCCGCCGACGCCGCCGCGGACACCCCGGAG
CCCCGCGAGGCACCGGCCGCTCCCACTCCCGCTGTCGCCGACGCCGCCGCTGCCGCCGAC
CCGGCTCCGGCCGCGGACGGCCGCACCGCCGCGCTGCGCTGGCTGGCCGAGCGGGTGGGC
CGGGCGATCGGCGTCCCGGCGGCCATGATCGCCGCCGACCGCCCGCTCCTGGACTACGGC
GTCGACTCCATCGCGGTGATGCGCCTCAGCCGGCTGCTGGAGGACGACCTGGGCCGGCTG
CCGGTCGCCCTGCTCCTCGACAGCTCCACCCTGGGCGAGTTGACCGACCGCCTGCTGCGC
GACCACGGAGCCCAGCTCACCGCGGCGGTCTCCGCGGAGACCGGGCCGGCCCCCGCCGAA
GCCCCCGCGGCCCCTGCGGCCCCCGCGGTCATCGGGGCCGCACCGGCCCCGGTCGACGCC
GCAGGCACCGAAGCCGTACCGCTGCCCGACCGCCTGATCGGGATGTGGACCTCCGACCAG
GCCGCGGCCCCGCTGGCGCCGTACAACATCTCCCTGTCCTGGCGGCTCGCCGACGCCGAC
CGCGCCGCGCTCGCCGGTGCGGTGGACGACCTGGTGCGCCGTCACCCGGTGCTCGGCTGC
TGCGTGCGCCCGCACCGCGGCGAACCGTCGTTCGTCCCCGCCCGGACGGCACCCGCCCTG
GTGGACCGCTCGCCCGAGGTCGGCATGGACCTCGCCACCGCCGTACGGCAGGAGGCCGAC
CGCCGCTTCGCGCCGGCGACCGAGCCGCTGCTGCGGCCCGTGCTCTGGCGGGACGGAACC
GACACCGTCGTCCAGCTGACCACGCACCACCTCGCCGCCGACGGCCGGTCGGCCGAGCTG
ATCGGCCAGGATCTCGCCGCCCTCTACGCGGCCCGGACCGGCGGGGGAACGGCCCTCGCC
CCGGCGCCCTCCTTCGCCGACGTCCTGCGCCGCGAGCGCGAGGACGCAGCCCGGACCCGC
GCCGCCGACGAGTCCTTCTGGGCCGCCCGGCTGGCACGGCTGACGGCCGGGCCGCTCTTC
CCGGACGCGGACACGGGCACCGACGCCGCGTCCGCGCAGCGCGAGTACGGACTGGGCGCC
GACCTGTCGGCACTGCTGTCCGCCACCGCCCGCACCGCCGGCGTGACCCCGTTCACCGTG
CTGCTGGCCGCCTTCGCGGCCTCCCTCGGCCGGCTGACCGGACGCCGCTCGTTCCTGCTC
GCGGTGCCCGCCTACGGCCGGGCCTCGGCGAGCGAGGACGACGCGGTCGGCTGCTTCGTC
AACTCCGTGCCGCTGCGCATCGACCTGGACCCGGCCCGTCCGGTCGCCGACTGGCTGACC
TCGCTCCACGACGAGGTCCGCGGTGCGGTCGGCCACGCCGGACTGCCCTACCCGCGGCTC
ACCGAGCTGTGCCGGGCCGCCGGGGAGCACACCGTCCCCACGGTGACCTTCGCCTACCAG
AACTGGCGCCGCGATACCGCCGGTGCCGCCCCGGGCGGACGCACGGACATCGGCCTGCCG
GTCCACCGGCGCGGCCAGCGCGGCCACTTCGACCTCGGACTGGAGGTCACCGACGGCCCC
GACGGGATGGACGTGCTCGCCAACCACCGCACGGGTGCGCTCGACGGCCCGGCCGTCGAC
GGCCTCGTCGAGGACCTGCGGCGCATGGTGGTCGAGCTGTCCCGGGACCTGGACGGCGGC
CGGACCGGCCGGCTGCTCGACCCCGCCGGGTCCACCCTGGTCAGCCGGTTCGCCGACTCG
GTCCGCCGCACCCCGGACCGCACCGCGGTCGAGGACCGGGACGATACGTTCAGCTACGCC
GCGCTGGACGAGCTCTCCGACGCCGTCGCCCGGCAGGTGTCGCGGGCCACCGGGCCCGGT
GAGCCGGTCGCGGTGCTGATGCACCGCTCGGCCCGGCTCGCGGCCGTCCTCCTCGGCATC
CTCAAGAGCGGCCGGCCCTACGTTCCGCTCGACGACTCCTACCCCGCCGACCGCCTGCGG
ATGGTGGTCGAGGGAGCGGAGTGCCGGCTCGCGGTCGCCGACCCCGACCTGGCCGCGCTG
CTGCCCGCCACCCTGCGGGTACTGCCCGCGGCCCAGGCCCTCGACCCGGCCGCCGCGCCG
GAGCCGGACTCCGGGCGGGGCACCGCACCCCTCCCCGGCGACCTGGCCTACCTGATGTTC
ACCTCGGGCAGCACGGGCCGGCCGAAGGGAGTCGGCGTCACCCACGGGAACGTCGTCCAC
ACCCTGGAGGCCATCGCGGCCACCACCGGAACCGGCCCGCAGGACCGCCTGCTCGCCGTC
ACGACGGTGTGCTTCGACATCTCCGTCCTGGAGCTGTTCATGCCGCTGCTGACCGGCGGC
ACCGTGGTGGTGGCCCGCCGCACCGACGTCGTCGACGCCCGGCGGCTGGCCGACCTGATC
GAGAGCCGGAACGTCACCGTTCTCCAGGCCACCCCGGCCGGCTGGCAGCTGCTGCTGGAC
GGCGGCTGGCGGGGCCGCGCGGGGCTGACCGCGCTGTGCGGCGGCGAGGCGCTGCCGCCG
AACCTGGCGGCCGGGCTGGTCTCCCGCACCGGCAGCCTGTGGAACGTCTACGGGCCCACC
GAGGCCACCATCTGGTCGACGATCGGACGCGTGGACGGCGCGGCCGTGCACCTCGGCGGT
CCGATCGGCGCGACCGACCTGGTCGTCACCGAGGTCGACGGCACGGCCGCGCCCGCCGCG
GGCGAGCCCGGCGAGCTGTGGATCGGCGGACCCGGCGTCGCCCAGGGCTACTGGCGCAGG
CCCGACCTGACGGCCGAACGGTTCACCGCCCACCCGGCCCGGCCCGAGGGCGGCGGACGC
TGGTTCCGCACCGGCGACCTGGTGCGGCGCGACGAGCAGGGCCGGCTGGTCTTCCTCGGC
CGGGCCGACAGCCAGGTCAAGATCCGCGGGCACCGCGTCGAGCTGGGCGAGATCGAGGCC
GTGCTCGGCACCCATCCGGGCCTGGCCCGGGTCGTGGTGGTGCTCCGCGGCGAGGGGGCG
CTGGTCCGGCTGGTGGCCGTCGCCGTCCCGGCGCGCGGCGCCGCCGCACCCGGCCTCGAC
GAGCTCCGCGCGTTCGCGGCGGCGAGCCTCCCGGCCTGGATGCTGCCCGACCGGCTGGTC
ACCACCCCCGAGCTGGCGCTCACGCCCAACGGCAAGGTGGACCGCAAGGCCGCCGCACTG
CTGGCCCGGCCCGCAGCGGAGCGGGAGGCCGCCACCGATCCGGTCCGGTCCGCAGATCCG
GCGCCCGCGCCGGTCCCGATGCCGCCTGCGGTCCACGCGCCAGCGCAGGCCGACCCGGCG
CGGATCCGACAGAGCGTCACCTCCTTCTGGGCCGAGCTCCTCGAACTCGACCACGTCCCC
GGTGACCGGCGGTTCTTCGACCTCGGCGGCAACTCGCTGCTGCTGGGCCGACTGTTCGCC
CGACTGGAGGACCGCTTCCCCGGCACCGGCCTGGAGGTCGCCGACCTCTTCGCCCGCCCA
CCCTCGACGACCAGGTGGCCCTGCTCACCGAGCGGCTCGCCCCGGCCGCACCCCCCGCCC
CGGCCGCCCCGGCCGCCCCGCCGCCCGGACCGCGCTGCCCCCTTCCGCTCCCGCTGCCCG
CCCGTCCCGCCGCGAGGCACGGCGCGCCCTTCGACTCGGAGACGACCACCGATGAACCAC
GACCACCACCCGTACGACGCGGTCGACGACCCGAACGCGGTGGCCGTCGTCGGCATGTCC
TGCCGCTTCGGCCCCGCCACCTCGGCGGACCGGCTCTGGGAGCTGCTGGAGCAGGGCCGC
AGCGGGATCCACCGCTACTCGCCCGAGGAGCTCGTCCGGCTGGGCCACCGGCCCGAGCTG
GTCCGGCGCCCCGGCTTCGTCCCCGCCGGCGTCGTCATGGAGGACGCCGACGCCTTCAAC
AACGAGTTCTTCGGCTACAGCCCGGTGCACGCCGAGTGGCTGGACCCGCAGCAGCGGGTC
CTGCTGGAGACGGCCTGGCACGCCCTGGAGGACGCCGGCTTCGCGCCGGACCGCACGGGG
CTGCGCACCGCCGCGTACGTCTCGGTCGGCCAGTCCACGATGCCGCAGGTCGGCATCACC
GACCTGGACGCGGCCGGCATGATCCGCTTCTCCTCCTCCGACAAGGACTTCGCCGCAAGC
CGGATCTCCTACAAGCTCGGCCTCACCGGCCCCAGCCTGACCGTGCAGTCCGCCTGCTCC
AGCGGACTGGTCGCCGTCCACCTCGCGGTGGAGAGCCTGCTCGGCGAGGAGAGCGACCTG
GCCGTCGTCGGCGCCGCCTCGCTGCACTTCCCGCAGGCGGGCTACCTCGCCGCACCGGAC
ATGATCCTCTCGCCGAGCGGCGAGTGCCGGCCGTTCGACGACGGCGCCGACGGCACGGTC
TTCGGCAACGGTGCCGGCGCGCTCGTACTGCGCCGGCTGGCCGACGCCGTCCGCGACGGC
GACCCGATCCGCGCGGTGATCCGCGGCAGCGCCGTCAACAACGACGGCGCCCGCAAGATG
GACTACCACGCCCCGTCCCCGGAGGGGCAGGAGGCAGTCCTGCGCGAGGCGCTGGCCGTC
GCCGGGATCGACGCGCACACCGTCGGCTACCTGGAGACCCACGGCACCGGCACCCACCTC
GGCGACCCGATCGAATACGCGGCCCTCGACCGCGTCTACGGCGGCGAGCGGCCGCACCCG
CCGCCATCGGCTCCGTCAAGAGCGTCGTCGGCCACCTCAACACCGCGGCCGGACTCGCCG
GCCTGGCCAAGGCTGATCCTCGCGCTGGAGCACGCCGCCGTGCCGCCGCAGGCCCCGTTC
GAGAAGCCCAACCGCCGGCTCGCCGGGACCGGCGGCCTGCGGATCGCCGCCGGCGGCGAC
GGCTGGCCCGTACCGGACGGCCCGCGCCGGGCCGCGGTCAGCTCCTTCGGCATCGGCGGC
ACCAACGCCCACGTGGTGCTGGAGCAGGCGCCCGACCTGCCGGCCCCGCCCGCCGGCAAC
GGCCACGACGAGCACCGGGTGCCCGTGTCCGCCCGTACCGAGGAAGCCCTGCGGCAGCTC
GCCGCCTCCCTGGCGGACTCCCTGGGCCGCCCCGGCGCCCCGGAGCCGGCCGACGTGGCG
CACACCTTGTCAACCGGCCGCAGCCACCGTGCCGTCCGGGCCGTGCTGACCGCGCGCACC
ACGGCCGAACTGGCGGAGCAACTGCGCACGCTCGCCCGGGAGGGCACCGCGGCAGCCGCG
ACTTCGGCCGCCCCCTACCGGGCGTGGATCGAAGGCACCGGCGAGCTGCCCGAACCGGAG
CCCGCCGCGGGCCGGACCGGCCGACGCGTCCGGCTGCCCGGCTACCCCTTCGCCCGCCGC
CGGTGGCCTCGCCCCGACGCCCCGGACCTCGCGCCGGACAACCGGTCGCCCGAGGCGGCC
ACCGACGCGCTCCCGGTCCGGACGGTGCGCCCCGGTGACCCGCTGGCGGCCGACCACCTC
GTCGGTGGGCTGCCGGTCTTCCCGGCCGCCGCCCAGATCGACCTCGCACTGACCGCCGCC
GGCCGACTCGCCGGCGGACCGGCAGCCGGCCTCGCCGACCTCGCGTTCCGCCGCACGGTC
GAGGTGGTGGACCCGGTCGAGCTGCGGGTGGAGATCGAGGACGGACAGGTCCGCGTGGCT
TCCACGGACGTCCACTCCCAGGCCCGCCTGCTTCCGGCCGGCGCACCGGAGCGGCCCGCC
CCGCTCGACCTCGCCGCCCTGCGCCGCTCGTACCCCGAATCGGCGGAACCCGAAGCCCTC
TACCGCTACTTCGCGGACAACGGCGTCGGCTACGGCCCGGCCTTCCGGGTCCTGCGCGAA
CTGCACCACGGTCCCGCCGGGGTGCTGGCCCGGGTGACCGCCGCACCGGAGTCCGTGCCC
GGCGAGACGGTCTCGCCCTGTGTCCTGGACGGCGCCCTCCAGTCCGTCATCGGCTGCGTC
CTGCGCGAGGACCTGGCCGGCGAGACCTTCATCCCGTTCGCCATCGACGAGCTGACGGTG
CACGCTCCGCTGCCCGGCGAGGTGTGGGTCACGGTCAGCCCGCAGCGGCTCGCCGGCGGC
GGCCGGCGGGTGCGCCGGTACGACGTGGCCGTCGCGGCGGAAGACGGCGCGGTCCTGCTG
ACGCTGCGCGGCCTCGCCCTGCGCCCGGTCACCGCCCCCGCTGCGGCCGGTGCGCCCGCC
GTGCCGCAGGGAGTCCACCTGTTCGCCTCCACCGCAGAGGAGTTCGCCCCGACCGGCCGG
GACGCCGCCACGGCCGGACCGCTGGTGCTGATCGGCGACACGGCCCTCGACGGCGCCGAC
CTGGTGCTCCCGGCGCCCGCCGACCCCGACGCCGCCGCGGCGGCCGGAGCCGAGCTGGCC
GCTCGGCTGCCCGCCGGCGGTGGCCGGCCGACCATCGTGTGGCCGGCCGCCGCCGACGAC
CCGCACACCGACCCCGCGGCCACCGCCACCGACGGCGCCCTGCGCGTCCTGGCCCTGCTG
CGCGCCCTGCTGCGACCGCTCGGCCGACGTGGCGCACACCTGGTCGTCCCCTACCCGGCA
GGCTCCCCGGCGGGTGCGGTGGCCGGCGCCGGCCTCGCGGCCCTGGGGCGCTCGCTGACC
GGTGAGAACCCCCGCTTCGACCTCACCGCCCTCGCCGTCGAGGACGGCGCCGGACCGGCC
GGGCTGCGCCGCGCGCTCGACGCCCTGACGGTGCGCGTGCCGCTCTCCCGTGCGCTGACC
GTCGCGGCCGACGGCGGGCTGAGGACCACCGTCCTGGCACCGCTCACCCCTGCGCCACGG
CGGGCGCTACTGGATCCACGGGATGGACGCCCCTCGACCTTGCAGGCATGCAAGCTTGGT
ATAGGGATCCACGGGATGGGACGCCTCGCCGCCCTCCTCGCCGAGCACCTGCTCGACCGT
CACGCCGCACGGATCGTGCTCACCGGCCGGTCCGCCGCCGACGGCGCGCGCGGCGAGGAG
CTGCGCCGGCTCGCCGACCGGGCGGCCCGGACCGGCGGTTCGGTCGAGTACCGGCAGCTG
GACCCGTCCGACCCGGCAGCCGTCGGCGACACCGCCCGGCGGATCGCTGCCGACGGCCCC
GCCGTGAACGGCGTCTTCCACTGCGCCGGGGTCCTGCGCGACGGGTACGTCCTGCGCAAG
ACGGTCGCCGACGCCCGCGACGTGATCGTTCCCAAGCTGGTCGGCGCGGCCGAGCTCGAC
TCGGCCACGGCCGACTGGGACCTGGACTGCTTCGTCGTCCTCTCCTCCGTGTCGGGCGCC
CTCGGCAGCGCCGGCCAGGCCGACTACGCCTTCGCCAACGCCGCCGCGGACGAACTGGTC
CGCCGCCGCGCGGACCGGGCCGGCCGGGGCCGTTCGGTCTCGATCGCCTGGCCGTTCTGG
GCGGACGGCGGGATGCGCCCGGACGGGCCGGCCCAGGAGGAACTGGCCACCCTCGGCATG
CGGGCCCTGCCCACCGAGGCCGGGCTCGCCGTACTGGAATCCCTGCTCGCCGGTCCCGCG
ACCGCGCCCGTGGTGCTGTACGGCGACCGGGAGGCCCTGCTCGCCTCCTTCCCGCTGCTG
ACCTCCGAGGCCCCCGCGGCCGTCCCGGAGCCGGCTCCGGCCCAGGCTCCGGCTCCGGCC
GCGGAACAGGCGGCACCCGCCGCCGCGCCGGCCGGGGAGGTGACCGCCGTCCTGCACCGG
CGGCTGGCGGCCGTCGTGGCCGAGGCGACACGCACTCCCGTCGACGACGTCACCGCCGAC
CGCCTCTTCGACGACCTGGGGATCGACTCCCTGCTCGCCATCCGGGTCGTCGAGCTGCTG
GAGAAGGACTTCGGGCGGCTCTCCAAGACCCTGCTGTTCGAGTGCCGTTCGGTGGAGGAG
CTCGCCGAGTACCTGAGGGAGGAGCACCCCGAGCGGTGTGCCGCGCTCGCGGGCGGACCG
AAGGAGACCACCGCCCCGGCCGCTCCCGCCGCCCAGGCCCCGGCTCCCGCCGCCCCGGCC
CAGGCCCCGGCTCCCGCCGTGTCCGCCATGCCGTCGGGGCCGTCCGACGACGACCTCGCC
GACCCGCGGGCGATCGCCGTGATCGGCGTTGCCGGACGCTTCCCCGAGGCCGACGGCCTC
GACCGGCTGTGGCGGAACCTGACGGAGGGCCGCGACAGCATCACCGAGGTCCCGGCCGAC
CGCTGGGACGCCGAGGCCCTCTACGACGCCGACAAGACCCGCGTCGACCGCACCCACACC
AAGTGGGGCGGATTCGTCGACGGCGTGGAGAACTTCGACGCCGCGCTCTTCAACATCTCG
CCCCGCGAGGCGGGGATCGTCGACCCGCAGGCCAGGCTGTTCCTGGAGAGCTGCTGGGCG
GCCCTCGACGACGCCGGCTACACCCCGGACCGTCTGGTGTCGGCCGCGGAGGACCCGGTG
CACCGGCGCGACGTCGGCGTGTTCGTCGGCGCGATGTACGGCGAGTACCAGCTCCACGAG
GCGGAGGAGCGGCTCAGGGGCAATCCCGTGCTGGCCAACAGCGCCTACTGGTCCATAGCC
AACCGGGTGTCCTACTTCTTCGACTTCCAGGGCCCGAGCGTCGCCGTCGACACGGCCTGC
TCCTCCGCGCTGACCGCCGTCCACCTGGCGGTCGAGTCGCTGCGGGCCGGCACGTCGCGG
GTCGCGATCGCGGGCGGCGTCAACGTCCTCATCCACCCCAACAAGTACTTCATGCTCGGC
CAGGGCAGGTTCGCCTCCAGCGACGGGCGCTGCCGCAGCTTCGGCGCCGGCGGCGACGGC
TATGTGCCGGGCGAGGGCGTCGGAGCCGTGCTCCTCAAGCCGCTGCGGGACGCGCTGCGC
GACGGCGACCACATCCACGCCGTGATTCGCGGCACCGCCGCCAACCACGGCGGCCGTACC
AACGGCTACACCGTGCCCAACCCCCGCGCCCAGGCCGACCTGGTGACGAAGGCGCTGCGG
GACGCCGGCCTGACCGCCCGCGACCTCGACTACATCGAGGCGCACGGCACCGGCACCGCG
CTCGGCGACCCGATCGAGATCCGCGGACTCGCCTCGGCGTTCGCCCGGGACGGCATCAAG
GGCCCGGGCAGCCTCCCGATCGGTTCGGTCAAGTCCAACGTCGGCCACCTGGAGTCGGCC
GCCGGTTCGGTGGCGCTCGCCAAGGTGCTGCTCCAGCTGCGCCACCGCACCCTGGTGCCG
TCGCTGCACGCCACCCCGCCCAACCCGGAGATCGACTTCGACGGGGTCCCGTTCAGCGTG
CAGCAGCAGCTCGCGCCGTGGCGCACCCACGACGGCGCCGCGCGCCCGCTGCGGGCCGGG
ATCAGCTCGTTCGGTGCCGGCGGCGGCAACGCCCACCTGATCGTCGAGGAGGCACCCGCG
CCCGCCCCGCGTCCGGCAACCGGCCGCCGGGAGCCGCAGGTACTGTTCCTGTCGGCCCGG
ACGGACACCGCGCTCGCCGCGTACGCCCGGGACCTGAGGGACCATCTGCTCCGGGCCCGT
TCCGCCGGCGAGGAGCCCTCGGCGGCCGACGTCGCCTTCACCTTCGCGGTCGGGCGCGTC
GACCTGGCCCGCCGCGCCGTCCTCCCGGCCGACTCGCTCGACCTGCTGCTCGCCGGTCTG
GAAGCCCTGGCCGAAGGCCGGCCGCGGCCCGTCCCGCCGGCCGGCGAGGAGATCGCCGCC
TGGCTCTCCGGCCGGCGCATCGACCGCGAGGCCGCCTGCGGTGCCGCGTCCGTCGGCCGC
CGCATCCCCCTGCCGCACTACCCGTTCGAACGTGTCCGCTGCTGGTACGACCTGCAGATC
GCCCACCTGCACCGGCAGGGCCTCGGCAGTGCCGGGCAGGAACCCGCGTTCGCCCGGGAC
CACTTGCGCGACTTCGGCCGGGCACCTTCCGACCGGCCGCAGGCCATGCCGGGTACCGCG
CCGGCGCCGGCCGCCGTGCCCGTGTCGGCCGCCGAAGGCGCGCAGGTCTCCGCGCCCACG
GGCGTACCCGCCCGGGCAGCGGTTCGCCCCGCCGTACCCGCGCCGACTGCCGTACCCACC
CTGACCCTGCGCGGTGCGGCCGAGCCGGCCCGCCGGCCGGCAACCGACCCGATGGAGAAG
CCACAGATGACCAGCGACCGCAAGATCTCGCTCCGGCCGCTCGCTCCGGCCACGGCCGCG
ACGAGGCCCGCTGCACCGGCGACCCCGGCGACCCCGGCGGCTCCCGCCGCCGTGCCCGCC
CCGCCTGCCGCACCGGCCCCTGCCGCCGTCCCGGCGGGCCGTCAGGAGGAGATCGCCGAG
GAGGTCGCCCGGCTGCTCGCCGGTGTGCTGTACCTCGAACCGGACCGGCTCGACCCGGAG
GAGACCTTCCTGACCCTGGGCGTCGACTCGATCCTCGGCGTGGAGTTCGTCGCTGCCGTG
AACGCCGCCTACCCGGTCGGAGTCAAGGCGACCGCCCTGTACGATCACCCGACGCCGGCC
GCGTTCGCCCGGCACATCGCCGAGTCGCTCGGAGCCCCCGCCCCGGCACCGACCTTCGCT
CCGGCCGTCCCGGCCTCTCCGGCCGTCCCGGCCGTGGCCGTCGACCCCGCCCCCGTCGCC
CGGGCACTGCGCGAGGAGCTGGCGCGGACGCTGTACTGCGAGCCCGGCGACATCGACGAC
GAGGCGAGTTTCAACACCCTCGGCCTGGACTCGATCCTCGGCGTGGAGTTCGTGGCGTTC
GTCAACCAGACCTACGGGCTGGACGAGAAGGCCGGCATCCTCTACGACCACCCCAGCCTG
GCCGCGCTGAGCCGCCACGTCGCCGGACGCGCCGCCCCGGTCCCGGCCGCCGCCGCGGAG
CCCGCCGCCCTCCCGCTGCCGGTGACCGGCGCCGGGGAGCCCTCCCAGGCGGACCTGGAC
GCGCTGCTCAGCGCCGTCCGCGACAACCGGCTGTCCATCGAGCAGGCGGTCACCCTGCTC
ACCCCGCGGCGCTGA
[1] KS17..390
[1] dh613..752
[1] KR1090..1270
[1] MT1487..1588
[1] ACP1691..1759
[1] ACP1801..1871
[2] KS1929..2306
[2] DH2517..2687
[2] KR3064..3249
[2] ACP3351..3419
[3] C3474..3750
[3] A3918..4313
[3] glycine4086..4185
[3] PCP4422..4480
[4] KS4553..4878
[4] DH5108..5258
[4] KR5605..5783
[4] ACP5878..5946
[5] KS6003..6384
[5] ACP6734..6807
[5] ACP6835..6908
[1] KS49..1170
[1] dh1837..2256
[1] KR3268..3810
[1] MT4459..4764
[1] ACP5071..5277
[1] ACP5401..5613
[2] KS5785..6918
[2] DH7549..8061
[2] KR9190..9747
[2] ACP10051..10257
[3] C10420..11250
[3] A11752..12939
[3] glycine12256..12555
[3] PCP13264..13440
[4] KS13657..14634
[4] DH15322..15774
[4] KR16813..17349
[4] ACP17632..17838
[5] KS18007..19152
[5] ACP20200..20421
[5] ACP20503..20724

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [3918-4313]  1.39999999999997e-101 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [3474-3750]  1.40000000000001e-33 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [3378-3393]  PS00012 [5905-5920]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1691-1780]  1.69999922284049e-16 SSF47336 [1794-1945]  6.49999377884395e-15 SSF47336 [3343-3436]  1.49999977583352e-13 SSF47336 [4415-4480]  2.19999900980708e-08 SSF47336 [5878-5989]  2.30000440726534e-17 SSF47336 [6731-6828]  2.90000354677981e-20 SSF47336 [6832-6927]  3.7999986264479e-16 SSF47336
SSF47336   ACP_like
 [1691-1759]  PS50075 [1801-1871]  PS50075 [3351-3419]  PS50075 [4422-4480]  PS50075 [5878-5946]  PS50075 [6734-6807]  PS50075 [6835-6908]  PS50075
PS50075   ACP_DOMAIN
 [1693-1758]  6.60000000000002e-12 PF00550 [1804-1870]  1.2e-06 PF00550 [3354-3418]  9.10000000000001e-10 PF00550 [4426-4478]  1.7e-06 PF00550 [5881-5945]  9.30000000000002e-12 PF00550 [6741-6806]  9.10000000000001e-13 PF00550 [6842-6907]  3.90000000000001e-09 PF00550
PF00550   PP-binding
 [1691-1761]  1.39999999999997e-93 G3DSA:1.10.1200.10 [1800-1872]  1.39999999999997e-93 G3DSA:1.10.1200.10 [3352-3423]  4.59999999999996e-94 G3DSA:1.10.1200.10 [4413-4480]  2.70000000000002e-81 G3DSA:1.10.1200.10 [5879-5951]  4.59999999999996e-94 G3DSA:1.10.1200.10 [6735-6810]  1.39999999999997e-93 G3DSA:1.10.1200.10 [6839-6910]  1.39999999999997e-93 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR010071 Amino acid adenylation domain (Domain)
 [3918-4313]  2.79999999999994e-116 TIGR01733
TIGR01733   AA-adenyl-dom
IPR013217 Methyltransferase type 12 (Domain)
 [1487-1588]  1.2e-16 PF08242
PF08242   Methyltransf_12
IPR013968 Polyketide synthase, KR (Domain)
 [1090-1269]  1.80000000000002e-43 PF08659 [3064-3247]  6.6999999999999e-45 PF08659 [5605-5783]  3.2e-44 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [17-257]  1.69999999999998e-70 PF00109 [1929-2181]  1.99999999999999e-77 PF00109 [4553-4796]  9.50000000000005e-57 PF00109 [6003-6258]  1.29999999999998e-85 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [265-390]  1.70000000000001e-33 PF02801 [2189-2306]  7.20000000000003e-38 PF02801 [4805-4878]  1.4e-21 PF02801 [6266-6384]  3.2e-39 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [18-269]  G3DSA:3.40.47.10 [271-443]  G3DSA:3.40.47.10 [1929-2192]  G3DSA:3.40.47.10 [2193-2366]  G3DSA:3.40.47.10 [4552-4807]  G3DSA:3.40.47.10 [4808-4972]  G3DSA:3.40.47.10 [6003-6269]  G3DSA:3.40.47.10 [6270-6440]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [15-444]  1.79999754022378e-84 SSF53901 [1921-2365]  3.49999466863949e-84 SSF53901 [4544-4972]  1.3000049540733e-67 SSF53901 [5995-6440]  2.50000909916183e-90 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1089-1299]  1.10000000000001e-99 G3DSA:3.40.50.720 [3063-3280]  1.10000000000001e-99 G3DSA:3.40.50.720 [5609-5816]  1.10000000000001e-99 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [4710-4726]  PS00606 [6171-6187]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1692-1762]  3.89999861795218e-15 SM00823 [1802-1874]  3.99999861686541e-07 SM00823 [3352-3422]  1.49999977583352e-15 SM00823 [5879-5949]  2.90000354677981e-17 SM00823 [6738-6810]  2.60000517657733e-17 SM00823 [6840-6911]  1.59999889349252e-14 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [2517-2687]  3.50000235434314e-12 SM00826 [5108-5258]  2.19999900980708e-13 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [18-444]  SM00825 [1931-2365]  SM00825 [4554-4972]  2.0000139277205e-120 SM00825 [6005-6440]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1090-1270]  3.80000697093586e-29 SM00822 [3064-3249]  3.70001063537244e-40 SM00822 [5605-5783]  2.30000440726534e-29 SM00822
SM00822   PKS_KR
IPR020845 AMP-binding, conserved site (Conserved_site)
 [4038-4049]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit