close all open/close all

CDS information : Virg_00260


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction89,546 / 87,834 / - [in whole cluster]
1 / 1,713 / + [in contig]
Locationcomplement(87834..89546) [in whole cluster]
1..1713 [in contig]
TypeCDS
Length1,713 bp (570 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative branched-chain alpha-keto acid dehydrogenase E2 component
Product (GenBank)dihydrolopoamide acyltransferase
GenebkdB
bkdC
Gene (GenBank)bkdB
EC number2.3.1.-
Keyword
  • virginiamycin M
  • isobutyryl-CoA
Note
Note (GenBank)
Reference
ACC
PmId
[17375285] Identification of the bkdAB gene cluster, a plausible source of the starter-unit for virginiamycin M production in Streptomyces virginiae. (Arch Microbiol. , 2007)

close this sectionSequence

selected fasta
>putative branched-chain alpha-keto acid dehydrogenase E2 component [dihydrolopoamide acyltransferase]
MSEKKTTTTLTVPRLGEGIVEVLILRLLKQPGDLVAKDELLYEMEHDKASLEIESPTAGR
LTAWLVEEGRRVPIGGAVAEIEPVAETEAVAGTGAPAEPGAAADGAGPAPAPAQGASPAG
PPGQPRTGTVRIPPRTRAHARRLGLDETVLATLVPARGRSLMPADLERHVADRACAAPEP
QQVRLQARSQDPVEGAKPVTPAPLTGAGHDFTDRPVSRRQKELNRALRSGTGDVVPAVVA
TEVREELLASALRARRAAGDGQSFTTAFQVFAHLAARVAADFPFLRSRRLGEDHLRVFDH
VDLGIACAGEDGDLTIGVVRGSDLLDADRFDERYADAVERALGGESQADGRVTLMLSHLG
DQGATFAVPVVVPPAAATLFLGAPSGSGPKAVRRIVLAFDHTVFNGQEAARFLDALRAEL
AQAGEPEAPVPAATNDRTRADGQQAREVRESALERLTALASEVADHAVDPDRPLGEQGID
SAKALRLTREAGRIFGTKLPATAIWKYPTLRALAELLPQTAPGEAPSNPAHADRADRAGR
VRAGRVRSGHVRSGHVRAGSGGRSGCPRAG
selected fasta
>putative branched-chain alpha-keto acid dehydrogenase E2 component [dihydrolopoamide acyltransferase]
ATGAGCGAGAAGAAGACGACGACCACCTTGACCGTCCCGCGACTGGGGGAGGGGATCGTC
GAAGTCCTGATCCTGCGTCTGCTGAAGCAGCCCGGTGACCTCGTCGCCAAGGACGAACTG
CTCTACGAGATGGAGCACGACAAGGCTTCCCTGGAGATCGAGTCGCCGACGGCCGGCAGG
CTGACCGCCTGGCTGGTCGAAGAGGGCCGACGGGTGCCGATCGGCGGAGCCGTCGCCGAG
ATCGAGCCGGTCGCCGAGACCGAGGCGGTCGCCGGGACCGGAGCACCCGCCGAGCCGGGC
GCAGCCGCCGACGGCGCAGGCCCGGCTCCCGCACCCGCGCAGGGCGCGTCGCCCGCCGGA
CCGCCCGGACAGCCCCGGACCGGCACCGTCCGCATCCCGCCCCGCACCCGGGCCCACGCC
CGCAGGCTGGGCCTGGACGAGACGGTCCTGGCGACCTTGGTTCCCGCCCGGGGGCGCAGC
CTGATGCCGGCCGACCTGGAGCGCCACGTCGCCGACCGCGCCTGCGCCGCCCCCGAGCCG
CAGCAGGTCCGGCTCCAGGCCCGGTCCCAGGACCCGGTCGAGGGCGCGAAGCCCGTCACC
CCGGCGCCGCTCACCGGCGCCGGCCACGACTTCACCGACCGGCCCGTCAGCCGGCGTCAG
AAGGAGCTCAACCGGGCGCTGCGTTCCGGCACCGGTGACGTGGTGCCTGCCGTCGTGGCC
ACCGAGGTCCGGGAAGAACTCCTCGCGAGCGCGCTGCGCGCCCGCCGCGCCGCCGGCGAC
GGCCAGAGCTTCACCACCGCCTTCCAGGTCTTCGCACACCTGGCTGCCCGTGTCGCCGCC
GACTTCCCGTTCCTGAGGTCGCGCCGCCTGGGCGAGGACCACCTGCGCGTCTTCGACCAC
GTGGACCTGGGCATCGCCTGTGCCGGTGAGGACGGTGATCTGACGATCGGCGTGGTGCGC
GGCTCCGACCTGCTGGACGCCGACCGGTTCGACGAGCGCTACGCCGACGCCGTCGAGCGC
GCCCTCGGCGGCGAGTCCCAGGCCGACGGCCGGGTCACCCTGATGCTCTCCCACCTCGGC
GACCAGGGCGCGACCTTCGCCGTCCCCGTCGTCGTGCCGCCCGCCGCCGCCACGCTGTTC
CTCGGAGCGCCGTCCGGCAGCGGGCCCAAGGCGGTCCGCCGGATCGTTCTGGCATTCGAC
CACACCGTGTTCAACGGCCAGGAGGCCGCCCGCTTCCTGGACGCCCTGCGGGCCGAGCTC
GCACAGGCCGGTGAACCGGAGGCACCCGTCCCGGCCGCGACGAACGACCGGACCCGGGCC
GACGGACAGCAGGCCAGGGAGGTCCGGGAGAGCGCGCTGGAGCGGCTCACGGCTCTCGCG
AGCGAGGTGGCCGACCACGCGGTGGATCCCGACCGCCCGCTCGGCGAGCAGGGCATCGAC
TCCGCCAAGGCCCTGCGCCTGACCCGTGAAGCGGGCCGGATCTTCGGGACCAAGCTGCCC
GCCACCGCGATCTGGAAGTACCCGACCCTGCGGGCCCTCGCCGAGCTGCTCCCGCAGACC
GCACCCGGCGAGGCGCCCTCGAACCCCGCCCACGCCGATCGCGCCGATCGCGCCGGTCGC
GTCCGTGCCGGTCGCGTCCGTAGCGGCCACGTCCGTAGCGGCCACGTCCGTGCCGGTTCC
GGTGGCCGTTCCGGATGCCCGCGGGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000089 Biotin/lipoyl attachment (Domain)
 [8-81]  PS50968
PS50968   BIOTINYL_LIPOYL
 [9-81]  1.6e-13 PF00364
PF00364   Biotin_lipoyl
IPR001078 2-oxoacid dehydrogenase acyltransferase, catalytic domain (Domain)
 [209-421]  2.70000000000002e-34 PF00198
PF00198   2-oxoacid_dh
IPR003016 2-oxo acid dehydrogenase, lipoyl-binding site (Binding_site)
 [32-61]  PS00189
PS00189   LIPOYL
IPR009081 Acyl carrier protein-like (Domain)
 [444-535]  6.69999687625999e-14 SSF47336
SSF47336   ACP_like
 [451-519]  8.60000000000001e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [455-517]  1.4e-09 PF00550
PF00550   PP-binding
 [448-518]  PS50075
PS50075   ACP_DOMAIN
IPR011053 Single hybrid motif (Domain)
 [3-103]  6.39998633403535e-21 SSF51230
SSF51230   Hybrid_motif
IPR023213 Chloramphenicol acetyltransferase-like domain (Domain)
 [211-421]  2.5e-16 G3DSA:3.30.559.10
G3DSA:3.30.559.10   CAT-like_dom
SignalP
 [1-36]  0.167 Signal
Eukaryota   
TMHMM No significant hit