close all open/close all

CDS information : Virg_00270


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction94,747 / 92,714 / - [in whole cluster]
1 / 2,034 / + [in contig]
Locationcomplement(92714..94747) [in whole cluster]
1..2034 [in contig]
TypeCDS
Length2,034 bp (677 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative branched-chain alpha-keto acid dehydrogenase E1 component
Product (GenBank)branched-chain alpha-keto acid decarboxylase
GenebkdA
bkdA/bkdB
Gene (GenBank)bkdA
EC number1.2.4.4
Keyword
  • virginiamycin M
  • isobutyryl-CoA
Note
Note (GenBank)
Reference
ACC
PmId
[17375285] Identification of the bkdAB gene cluster, a plausible source of the starter-unit for virginiamycin M production in Streptomyces virginiae. (Arch Microbiol. , 2007)

close this sectionSequence

selected fasta
>putative branched-chain alpha-keto acid dehydrogenase E1 component [branched-chain alpha-keto acid decarboxylase]
MPDAAPDAKKKKAKSSENVLSRAGGTGDTIPRDRRAAFLEQMMLSRECDRRSGIVLRQGQ
AWFHISSAGHEALAALCELLEPEDLIFPHYRDRTLMLARGMDAEGQARDLMAKGGSHSAG
RNMSSHFSHRPGNVFSLASPTGSQCLPAAGAAWASVLSGERKVVVCSIGDASTRQGEFFE
ALAFAVERKLPVVFLVSDNRYGISTPTDGLSPQRLGLMPDAITKVVDGSDPDAVHAAAAA
VLPDVRAGRGPAVLWCRLDRLDSHTSSDDQRLYRTKDELAAMRDPVALFTDRLEAEGTIV
PGWADQVRARLADDVEEVFDRVAGEPSADPGEVMDHLFAAADEQPTAPADTRPCGGTMVE
AVNRALRTGLENDPTLVLFGEDIEDPKGGVFGFTKGLGTLAGPRMTNSPLAEATIVGAAV
GLAAAGMRPVVELQFVDFAGPAWNQIASQLTTLRWRTASAWRCPVVIYAPWGGYLPGGGI
WHSQSNESLFTHLPGLRVVVPSTPEDTEAVFLESFASPDPTLILLPKHLMRRQHPPQPGP
APARGARLLRTGADVTIATWGNGTELATEAADRLAAEGVGTEVIDLRWLTPVDREAVAAS
VRRTGRLVVVQEDNRTSSFGATVLADLLGSDDEFYSLLAPPRLVSRRDVHIPFHPDLESA
VLPAADDVVAAIRSVLA
selected fasta
>putative branched-chain alpha-keto acid dehydrogenase E1 component [branched-chain alpha-keto acid decarboxylase]
GTGCCCGACGCTGCTCCGGATGCGAAGAAGAAAAAGGCCAAGAGTTCCGAGAACGTGCTG
TCGCGCGCCGGCGGAACCGGGGACACGATTCCCCGGGACCGGCGAGCGGCCTTTCTGGAG
CAGATGATGCTCTCGCGCGAATGCGACCGGCGTTCCGGGATCGTTCTGCGGCAGGGCCAG
GCGTGGTTCCACATCTCATCGGCCGGCCACGAAGCCCTCGCAGCCCTGTGTGAACTGCTG
GAACCCGAGGACCTGATCTTCCCCCACTACCGCGACCGCACCCTGATGCTGGCGCGCGGA
ATGGATGCCGAAGGACAGGCCCGTGACCTCATGGCCAAGGGCGGATCGCATTCCGCCGGA
CGTAATATGAGTTCGCACTTCAGCCACCGCCCGGGAAATGTCTTCTCCCTCGCCAGCCCG
ACCGGAAGCCAGTGCCTGCCGGCGGCCGGCGCCGCGTGGGCGTCCGTACTGAGCGGCGAG
AGGAAGGTCGTCGTCTGCTCCATCGGCGACGCCTCGACGCGACAGGGTGAATTCTTCGAA
GCGCTCGCCTTCGCGGTCGAACGGAAACTCCCGGTCGTCTTCCTCGTCTCCGACAACCGC
TACGGAATCAGCACCCCGACCGACGGCCTCTCGCCGCAGCGGCTCGGCCTGATGCCGGAC
GCGATCACCAAGGTCGTCGACGGGTCGGACCCGGACGCCGTGCACGCCGCCGCGGCCGCC
GTGCTGCCGGACGTCCGCGCCGGCCGGGGCCCGGCCGTGCTGTGGTGCCGGCTGGACAGG
CTCGACTCGCACACATCCTCCGACGACCAGCGGCTCTACCGCACCAAGGACGAACTCGCC
GCCATGCGCGACCCGGTGGCCCTCTTCACCGACCGGCTGGAAGCCGAGGGGACGATCGTC
CCCGGCTGGGCGGACCAGGTCCGGGCCCGGCTCGCCGACGACGTCGAGGAGGTCTTCGAC
CGTGTGGCCGGAGAACCCTCCGCCGACCCCGGCGAGGTGATGGACCACCTGTTCGCCGCG
GCGGACGAGCAGCCGACCGCCCCCGCCGACACCCGCCCCTGCGGCGGAACGATGGTCGAG
GCGGTGAACCGGGCCCTGCGCACCGGGCTGGAGAACGACCCGACGCTGGTGCTGTTCGGC
GAGGACATCGAGGACCCGAAGGGCGGCGTCTTCGGATTCACCAAGGGCCTCGGCACCCTC
GCCGGCCCCCGGATGACCAACTCCCCGCTCGCCGAGGCCACCATCGTCGGCGCCGCCGTC
GGGCTCGCTGCGGCCGGCATGCGGCCGGTGGTCGAGCTCCAGTTCGTCGACTTCGCCGGA
CCGGCCTGGAACCAGATCGCCTCCCAGCTGACCACCCTGCGCTGGCGGACGGCCTCCGCC
TGGCGCTGCCCCGTCGTGATCTACGCACCCTGGGGCGGCTACCTGCCGGGCGGCGGAATC
TGGCACAGCCAGAGCAACGAGAGCCTGTTCACCCACCTGCCCGGGCTGCGGGTCGTGGTG
CCCTCCACCCCCGAGGACACCGAGGCGGTCTTCCTGGAGTCCTTCGCATCCCCCGACCCG
ACGCTGATCCTGCTCCCCAAGCACCTGATGCGCCGCCAGCACCCGCCGCAGCCCGGACCG
GCACCCGCCCGGGGCGCCCGGCTGCTGCGTACCGGAGCCGACGTCACCATCGCCACCTGG
GGCAATGGCACCGAACTGGCCACGGAGGCGGCGGACCGGCTGGCCGCCGAGGGCGTCGGC
ACCGAGGTGATCGACCTGCGCTGGTTGACCCCGGTCGACCGAGAGGCGGTCGCCGCCTCC
GTCCGGCGGACCGGCCGTCTGGTGGTGGTCCAGGAGGACAACCGCACCAGCAGTTTCGGC
GCCACCGTCCTGGCCGACCTCCTCGGCAGTGATGACGAGTTCTACTCGCTGCTCGCGCCG
CCCCGGCTCGTATCCCGCCGGGACGTCCACATCCCCTTCCACCCCGACCTGGAGAGCGCC
GTGCTGCCCGCGGCGGACGACGTGGTCGCGGCCATCCGATCGGTGCTGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001017 Dehydrogenase, E1 component (Domain)
 [42-328]  3.40000000000004e-40 PF00676
PF00676   E1_dh
IPR005475 Transketolase-like, pyrimidine-binding domain (Domain)
 [357-531]  3e-31 PF02779
PF02779   Transket_pyr
 [356-533]  1.20000117458134e-49 SM00861
SM00861   Transket_pyr
IPR005476 Transketolase, C-terminal (Domain)
 [546-665]  3.2e-25 PF02780
PF02780   Transketolase_C
IPR009014 Transketolase, C-terminal/Pyruvate-ferredoxin oxidoreductase, domain II (Domain)
 [540-677]  1.29999924468179e-31 SSF52922
SSF52922   Transketo_C_like
IPR015941 Transketolase-like, C-terminal (Domain)
 [548-673]  2.70000000000002e-34 G3DSA:3.40.50.920
G3DSA:3.40.50.920   Transketo_C_like
SignalP No significant hit
TMHMM No significant hit