close all open/close all

CDS information : Virg_00280


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction95,484 / 94,867 / - [in whole cluster]
737 / 120 / - [in contig]
Locationcomplement(94867..95484) [in whole cluster]
complement(120..737) [in contig]
TypeCDS
Length618 bp (205 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)BarZ
Gene
Gene (GenBank)barZ
EC number
Keyword
Note
  • This ORF is involved in both virginiamycin M and virginiamycin S biosynthesis.
Note (GenBank)
  • BarB homolog
Reference
ACC
PmId
[10792718] Identification of an AfsA homologue (BarX) from Streptomyces virginiae as a pleiotropic regulator controlling autoregulator biosynthesis, virginiamycin biosynthesis and virginiamycin M1 resistance. (Mol Microbiol. , 2000)
[14647980] Identification by gene deletion analysis of barB as a negative regulator controlling an early process of virginiamycin biosynthesis in Streptomyces virginiae. (Arch Microbiol. , 2004)
Family/Domain
FD
IPR001647

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [BarZ]
MQQRSVITCRRLVTAAAELFDRKGYVNATLGEITGAARVTKGALYFHFASKGELAHAVEE
HGCTLLRPVGRPARRRQQLTAADPDRLHPLAGPGAARGSRAPRNFRLSRELRGGEAVGGG
FTEAWMTTAWSLLDRAGAAGELRNGADRAGTADAARPRRWPASNCSLPPTCRTRNSPPGS
LPCGTSLCPGLVGPSGRTDYRTTPR
selected fasta
>putative TetR family transcriptional regulator [BarZ]
ATGCAGCAGAGATCGGTGATCACCTGTCGGAGGCTGGTGACCGCTGCAGCGGAACTGTTC
GACCGCAAGGGGTACGTGAACGCGACCCTGGGGGAGATCACCGGTGCGGCACGGGTCACC
AAGGGGGCCCTGTACTTCCACTTCGCCTCCAAGGGCGAACTGGCCCACGCCGTGGAGGAG
CACGGCTGCACCCTGCTTCGCCCAGTCGGTCGACCGGCTCGCCGCCGGCAGCAGCTCACC
GCTGCAGACCCTGATCGACTTCACCCACTGGCTGGCCCGGGGGCTGCGCGAGGAAGCCGC
GCTCCGCGCAACTTCCGCCTCAGCAGGGAACTGCGCGGCGGGGAGGCGGTCGGCGGCGGC
TTCACCGAGGCGTGGATGACCACCGCCTGGTCGCTGCTCGACCGGGCCGGTGCGGCGGGG
GAACTGCGCAACGGCGCCGACCGCGCGGGAACCGCAGACGCTGCTCGCCCGCGGCGGTGG
CCGGCATCGAACTGCTCGCTGCCACCGACATGTCGGACGAGGAACTCACCGCCCGGGTCG
CTGCCCTGTGGGACCTCGCTCTGCCCCGGCCTGGTCGGGCCGTCCGGACGGACCGACTAT
CGGACGACTCCCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [6-66]  PS50977
PS50977   HTH_TETR_2
 [12-25]  9.00000407957274e-10 PR00455 [33-56]  9.00000407957274e-10 PR00455
PR00455   HTHTETR
 [12-58]  2.4e-14 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [1-76]  6.09999977126211e-15 SSF46689
SSF46689   Homeodomain_like
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [1-154]  1.4e-20 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
IPR023772 DNA-binding HTH domain, TetR-type, conserved site (Conserved_site)
 [24-54]  PS01081
PS01081   HTH_TETR_1
SignalP
 [1-17]  0.343 Signal
Eukaryota   
TMHMM No significant hit