close all open/close all

CDS information : Virg_00290


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction96,333 / 95,518 / - [in whole cluster]
1,586 / 771 / - [in contig]
Locationcomplement(95518..96333) [in whole cluster]
complement(771..1586) [in contig]
TypeCDS
Length816 bp (271 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional regulator
Product (GenBank)Orf2
GenevmsR
Gene (GenBank)
EC number
Keyword
  • SARP family
Note
  • This ORF is involved in both virginiamycin M and virginiamycin S biosynthesis.
Note (GenBank)
  • homolog of DnrI, RedD, ActII-orf2; probable pathway-specific regulator for virginiamycin biosynthesis
Reference
ACC
PmId
[11029453] Identification by gene deletion analysis of a regulator, VmsR, that controls virginiamycin biosynthesis in Streptomyces virginiae. (J Bacteriol. , 2000)
[19332826] Hierarchical control of virginiamycin production in Streptomyces virginiae by three pathway-specific regulators: VmsS, VmsT and VmsR. (Microbiology. , 2009)

close this sectionSequence

selected fasta
>transcriptional regulator [Orf2]
MDIDVLGSLTVREGGAPVALTAPKPRQLHAVLAMHADRTVPVPLLIEELWEGRPPRSARN
TLQTYILQLRELIGQALRLAGDAHDAKRVLVTEPDGYRLDTRGGAIDTHEFERRAASGYR
AMAQEDFAAASRRLHDALALWQGPAFAGIRTGALLEMEIRRLEEARLCALDQRIEADLRL
GRHRELVGELTVLASRHRMHESLHRQLMIALHRSGRRAEALAAYQRLRTTLVRDLGLEPS
PALRRLQHSMLASGPEREAVEPAWGQLAPTG
selected fasta
>transcriptional regulator [Orf2]
GTGGACATCGACGTGCTGGGATCGCTGACCGTACGAGAGGGCGGGGCGCCCGTGGCTCTG
ACCGCCCCCAAGCCGCGCCAACTGCACGCCGTCCTGGCGATGCACGCGGACCGGACGGTG
CCGGTGCCGCTTCTGATCGAGGAACTGTGGGAAGGCCGGCCCCCGCGATCGGCCCGCAAC
ACCCTCCAGACCTACATCCTCCAGCTCCGCGAACTGATCGGCCAGGCACTGCGGCTCGCC
GGCGACGCGCACGACGCCAAGCGGGTCCTCGTCACCGAACCCGACGGCTACCGCCTGGAC
ACCAGAGGCGGCGCCATCGACACCCACGAGTTCGAGCGCCGGGCCGCATCCGGCTACCGG
GCCATGGCCCAGGAGGACTTCGCCGCCGCCTCCCGCCGCCTGCACGACGCGCTTGCCCTG
TGGCAGGGGCCGGCCTTCGCGGGCATACGCACCGGCGCGCTGCTCGAGATGGAGATCCGC
CGCCTCGAGGAGGCCCGGCTGTGCGCCCTCGACCAGCGGATCGAGGCCGATCTGCGGCTC
GGCCGGCACCGAGAACTGGTCGGCGAGCTGACCGTTCTGGCGTCCCGTCACCGCATGCAC
GAGTCGCTGCACCGTCAGCTGATGATCGCGCTCCACCGCTCGGGCCGGCGCGCAGAGGCA
CTCGCCGCCTACCAGCGGCTGCGTACGACGCTCGTTCGCGACCTGGGCCTGGAGCCCTCA
CCGGCCCTGCGCCGCCTCCAGCACTCGATGCTCGCGTCCGGCCCGGAGCGGGAGGCCGTC
GAACCGGCCTGGGGGCAACTCGCCCCCACCGGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [15-99]  6.29999562859499e-10 SM00862
SM00862   Trans_reg_C
 [21-99]  4.5e-17 PF00486
PF00486   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [106-251]  4.70000000000003e-53 PF03704
PF03704   BTAD
 [106-251]  5.40001756046195e-54 SM01043
SM01043   BTAD
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [10-100]  7.90000000000001e-08 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-100]  1.59999889349252e-12 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-30]  0.115 Signal
Bacteria, Gram-negative   
TMHMM No significant hit