close all open/close all

CDS information : Virg_00300


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction96,781 / 98,388 / + [in whole cluster]
2,034 / 3,641 / + [in contig]
Location96781..98388 [in whole cluster]
2034..3641 [in contig]
TypeCDS
Length1,608 bp (535 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding protein
Product (GenBank)VarM
Gene
Gene (GenBank)varM
EC number
Keyword
Note
Note (GenBank)
  • probable ABC transporter for virginiamycin
Reference
ACC
PmId
[14647980] Identification by gene deletion analysis of barB as a negative regulator controlling an early process of virginiamycin biosynthesis in Streptomyces virginiae. (Arch Microbiol. , 2004)
Family/Domain
FD
IPR003439

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding protein [VarM]
MTLTNTSVVCADLSFAWPDGTPVFTDFSLVVGTGRTGLIGVNGSGKSTLLRLMAGALTPS
GGSVKVTGELGYLPQNVALEPEVRVEQALGIAEIRAAIDAIEGGDTSEELYTVIGDNWDV
EERARATLDKLGLTHVTLDRRIGELSGGESVMLCLAAQFLLRPDVLLLDEPTNNLDLEAR
RRLYEAVGSWKGSIVIVSHDRELLDLVDQIADLRSGEVRWYGGNFSDYEEALAVEQEAAE
RMVRVAESDVHRQKRELADARIKLDRRVRYGNKMYETKREPKVVMKERKRQAQVAAGKHR
NMHLERLEEAKERLTEAEEAVRDDREIRVDLPETSVPAGRTVLTLRDVELRFGSRAHFEV
RGPERIALVGRNGAGKSTLLRTVVGEIPAGGGRGEGRRPDALSPQRLDLLDEELTVAQNV
GRFAPGATDNVIRSRLARFLFRGRKADQLVGTLSGGERFRATLAALLLADPAPQLLMLDE
PTNNLDLASVQQLTQALQSYQGALIVVSHDLAFLRDLQITRWIRVDGGTADIDPM
selected fasta
>putative ABC transporter ATP-binding protein [VarM]
ATGACCTTGACCAACACATCCGTCGTCTGCGCCGACCTCTCCTTCGCCTGGCCCGACGGG
ACCCCGGTGTTCACCGACTTCTCCCTGGTCGTGGGCACCGGCCGGACCGGGCTGATCGGC
GTCAACGGCTCGGGCAAATCCACCCTGCTCCGGTTGATGGCCGGAGCGCTCACGCCGAGC
GGCGGCTCGGTCAAGGTGACCGGCGAACTCGGCTACCTGCCACAGAACGTCGCGCTGGAG
CCGGAGGTCCGCGTCGAGCAGGCGCTGGGCATCGCGGAGATCCGCGCTGCCATCGACGCG
ATCGAGGGCGGCGACACCTCCGAGGAGCTCTACACCGTGATCGGTGACAACTGGGACGTC
GAGGAGCGCGCCCGGGCGACGCTGGACAAGCTGGGGCTGACGCACGTGACGCTGGACCGC
CGGATCGGCGAACTGTCCGGCGGGGAGTCAGTCATGCTCTGCCTGGCGGCCCAGTTCCTG
CTCCGCCCCGATGTCCTGCTGCTCGACGAGCCGACCAACAACCTCGACCTGGAGGCACGC
CGCCGGCTGTACGAGGCGGTCGGCTCCTGGAAGGGCTCGATCGTGATCGTCAGCCACGAC
CGGGAACTGCTCGACCTGGTCGACCAGATCGCCGACCTGCGCAGCGGCGAAGTGCGCTGG
TACGGAGGCAACTTCAGCGACTACGAGGAGGCCCTGGCCGTGGAGCAGGAGGCGGCCGAG
CGCATGGTGCGCGTGGCCGAGTCCGACGTCCACCGCCAGAAGCGGGAGCTGGCCGACGCA
CGGATCAAGCTGGACCGCCGCGTCCGCTACGGCAACAAGATGTACGAGACCAAGCGCGAG
CCCAAGGTCGTGATGAAGGAGCGCAAGCGGCAGGCCCAAGTAGCCGCGGGCAAGCACCGC
AACATGCACCTGGAGCGGCTGGAGGAGGCCAAGGAGCGGCTGACCGAGGCCGAGGAGGCG
GTGCGCGACGACCGGGAGATCCGGGTCGACCTGCCCGAGACCTCGGTACCTGCGGGCCGC
ACCGTCCTCACCCTGCGCGACGTCGAGCTCCGCTTCGGCAGCCGGGCCCACTTCGAGGTG
CGGGGGCCGGAGCGGATCGCCCTGGTGGGACGCAACGGGGCGGGCAAGAGCACGCTGCTG
CGCACCGTCGTCGGGGAGATACCCGCCGGTGGCGGGCGAGGTGAAGGCCGCCGTCCCGAT
GCGCTATCTCCGCAGCGGCTCGACCTGCTCGACGAGGAGCTGACGGTGGCGCAGAATGTC
GGCCGGTTCGCTCCCGGCGCCACCGACAACGTCATCCGCTCCCGCCTGGCCCGCTTCCTC
TTCCGCGGCCGGAAAGCGGACCAACTGGTCGGTACTCTATCGGGTGGCGAGCGGTTCCGG
GCGACGCTGGCGGCGCTGCTGCTGGCCGACCCCGCGCCGCAGCTGCTGATGCTCGACGAG
CCGACCAACAACCTGGACCTGGCGAGCGTGCAGCAGCTCACGCAGGCCCTGCAGTCCTAC
CAGGGCGCGCTCATCGTGGTCAGCCACGACCTGGCGTTCCTGCGGGACCTCCAGATCACC
CGGTGGATCCGGGTCGACGGCGGGACGGCGGACATCGATCCGATGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [47-173]  1.5e-20 PF00005 [402-483]  2.5e-09 PF00005
PF00005   ABC_tran
 [8-240]  PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [32-217]  9.20000434662057e-15 SM00382 [362-533]  2.19999900980708e-10 SM00382
SM00382   AAA
IPR017871 ABC transporter, conserved site (Conserved_site)
 [145-159]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP
 [1-16]  0.311 Signal
Eukaryota   
 [1-11]  0.585 Signal
Bacteria, Gram-negative   
TMHMM No significant hit