close all open/close all

CDS information : Virg_00310


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction98,512 / 99,285 / + [in whole cluster]
36 / 809 / + [in contig]
Location98512..99285 [in whole cluster]
36..809 [in contig]
TypeCDS
Length774 bp (257 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.6 biosynthesis of butyrolactone
Productgamma-butyrolactone biosynthesis enzyme
6-dehydro-virginiae butanolide A reductase
Product (GenBank)Orf4
GenebarS1
Gene (GenBank)orf4
EC number
Keyword
Note
Note (GenBank)
  • ketoacyl ACP/CoA reductase homolog
Reference
ACC
PmId
[10792718] Identification of an AfsA homologue (BarX) from Streptomyces virginiae as a pleiotropic regulator controlling autoregulator biosynthesis, virginiamycin biosynthesis and virginiamycin M1 resistance. (Mol Microbiol. , 2000)
[12193632] barS1, a gene for biosynthesis of a gamma-butyrolactone autoregulator, a microbial signaling molecule eliciting antibiotic production in Streptomyces species. (J Bacteriol. , 2002)

close this sectionSequence

selected fasta
>gamma-butyrolactone biosynthesis enzyme [Orf4]
MTDRQGLLTDRIALITGASSGIGAAQRGLFAREGAAVVVTARREERLAGLVDELRAQGAR
AAYVVADVTRSEDAVRAVEFTVERFGRLDAAFNKRRHGAGRTPLHLMDDPVYDDIMDTNV
RGVFNCLRPEIAAMLASGAGGSIVNTSSTGGLVATPVAAPYVVSKHAVLGLTKGPAAEYG
AHGIRVNAIAPGTTRSEMVADWFAQNPDAEELLHRATPQPRTAEPQEIAEAAAWLCSERA
SFVTGSTLVVDGGFTIL
selected fasta
>gamma-butyrolactone biosynthesis enzyme [Orf4]
ATGACTGATCGACAAGGGCTTCTGACAGACAGGATCGCACTGATAACGGGAGCCAGCAGC
GGCATCGGCGCGGCGCAGCGCGGGTTGTTCGCCAGGGAGGGCGCGGCGGTGGTGGTCACC
GCCCGCCGCGAGGAGCGGCTGGCCGGGCTGGTGGACGAGTTGCGGGCGCAGGGCGCCCGA
GCCGCATACGTGGTCGCCGACGTGACCCGGTCCGAGGACGCGGTACGTGCCGTCGAGTTC
ACGGTGGAACGTTTCGGCAGGCTCGATGCCGCGTTCAACAAACGCCGGCACGGGGCCGGC
CGCACACCGCTGCACCTGATGGACGACCCGGTCTACGACGACATCATGGACACCAACGTG
CGCGGGGTGTTCAACTGCCTGCGCCCGGAGATCGCGGCGATGCTCGCATCCGGAGCAGGC
GGTTCGATCGTCAACACCAGCAGCACCGGCGGCTTGGTCGCCACTCCGGTCGCCGCGCCG
TACGTGGTGTCCAAGCACGCGGTGCTCGGTCTGACCAAAGGGCCTGCCGCCGAGTACGGC
GCCCACGGCATTCGGGTCAACGCGATAGCCCCCGGCACGACCCGCAGCGAGATGGTGGCG
GACTGGTTCGCGCAGAACCCGGATGCCGAGGAGCTGCTGCACCGGGCCACGCCGCAGCCC
CGTACCGCCGAACCCCAGGAGATCGCCGAGGCCGCTGCGTGGCTGTGCAGCGAGCGGGCG
TCCTTCGTCACCGGGTCGACCCTGGTGGTCGACGGCGGGTTCACCATCCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [12-29]  7.60000011115812e-32 PR00081 [135-151]  7.60000011115812e-32 PR00081 [161-180]  7.60000011115812e-32 PR00081 [182-199]  7.60000011115812e-32 PR00081 [218-238]  7.60000011115812e-32 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [5-256]  4.59999999999996e-77 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [148-176]  PS00061
PS00061   ADH_SHORT
SignalP No significant hit
TMHMM No significant hit