close all open/close all

CDS information : Virg_00320


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction100,271 / 99,291 / - [in whole cluster]
1,795 / 815 / - [in contig]
Locationcomplement(99291..100271) [in whole cluster]
complement(815..1795) [in contig]
TypeCDS
Length981 bp (326 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.6 biosynthesis of butyrolactone
Productputative gamma-butyrolactone biosynthesis enzyme
Product (GenBank)Orf5
GenebarS2
Gene (GenBank)orf5
EC number
Keyword
Note
Note (GenBank)
  • dNDP-glucose dehydratase homolog
Reference
ACC
PmId
[18034227] Identification by gene deletion analysis of barS2, a gene involved in the biosynthesis of gamma-butyrolactone autoregulator in Streptomyces virginiae. (Arch Microbiol. , 2008)
Family/Domain
FD
IPR001509

close this sectionSequence

selected fasta
>putative gamma-butyrolactone biosynthesis enzyme [Orf5]
GSGSGHGSTGSSAAGRRRRPYAPGRPPRRGGTL-PAPP-KDPAVRYVHADLTDSASLYGV
CDGIDIVLHCAARVGGPEHSARAVNEEGTRALLAEAERAGVRRFVQVGTASVYGRGVFRN
AGPEHLPVVPQSPTSRTRAAAERLVLAAGGTVLRPHLVIGPATAWVVPGLVRLHQRLAAS
VDGWRARMSVVDVDDLARAVIAVAVAPQDTCGVWHANHPEPVGCARIFDALVRLLGLPAG
TGDIEAGGARRLLAEHPVLLHHLAMLTTDHWFASSRLWRETGCPAGARSRRASPATPRGT
AN-LATDTAGRPGRRACRKSGRSSGGS
selected fasta
>putative gamma-butyrolactone biosynthesis enzyme [Orf5]
GGATCCGGATCTGGTCACGGATCGACCGGTTCATCGGCGGCAGGGCGCCGCCGCCGCCCG
TACGCTCCCGGGCGCCCGCCTCGTCGTGGCGGGACGCTCCNACCGGCCCCGCCGNAAAAG
GACCCCGCGGTCCGGTACGTCCACGCCGACCTCACCGACTCGGCAAGCCTGTACGGCGTG
TGCGACGGCATCGACATCGTGCTCCACTGCGCGGCGCGGGTCGGCGGCCCGGAGCACTCG
GCCCGGGCGGTCAACGAGGAGGGCACCCGGGCACTGCTGGCCGAGGCTGAACGGGCCGGA
GTCCGCCGCTTCGTCCAGGTCGGCACCGCCTCCGTGTACGGCCGGGGGGTGTTCCGGAAC
GCCGGACCCGAGCACCTCCCCGTCGTGCCGCAATCGCCCACCAGCCGGACCCGTGCCGCC
GCCGAGAGGCTCGTGCTCGCGGCCGGCGGGACGGTGCTGCGCCCGCACCTGGTCATCGGG
CCGGCGACCGCCTGGGTGGTCCCGGGTCTGGTCCGCCTCCACCAGCGGCTCGCGGCCTCC
GTCGACGGCTGGCGGGCCCGGATGTCGGTGGTCGACGTCGACGACCTCGCCCGTGCGGTG
ATCGCCGTCGCCGTCGCCCCCCAGGACACCTGCGGCGTCTGGCACGCCAACCACCCCGAA
CCGGTCGGCTGCGCCCGCATCTTCGACGCACTGGTACGCCTGCTCGGCCTGCCCGCGGGC
ACCGGCGACATCGAAGCCGGTGGGGCCCGTCGCCTCCTCGCCGAGCACCCGGTCCTGCTG
CACCACCTCGCCATGCTGACCACCGACCACTGGTTCGCCAGCTCCCGGCTCTGGCGCGAG
ACCGGCTGCCCGGCCGGGGCACGTTCGAGGAGAGCCTCGCCCGCCACGCCTCGTGGTACC
GCGAACNACCTCGCGACGGACACCGCAGGCCGGCCGGGCCGACGGGCATGCCGGAAGTCC
GGGCGGTCCTCCGGCGGATCG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [43-208]  9.7e-17 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [39-238]  1.4e-31 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-30]  0.28 Signal
Bacteria, Gram-negative   
TMHMM No significant hit