close all open/close all

CDS information : Virg_00330


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction101,243 / 100,359 / - [in whole cluster]
244 / 1,128 / + [in contig]
Locationcomplement(100359..101243) [in whole cluster]
244..1128 [in contig]
TypeCDS
Length885 bp (294 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.6 biosynthesis of butyrolactone
Productgamma-butyrolactone biosynthesis enzyme
regulatory protein
Product (GenBank)BarX
Gene
Gene (GenBank)barX
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10792718] Identification of an AfsA homologue (BarX) from Streptomyces virginiae as a pleiotropic regulator controlling autoregulator biosynthesis, virginiamycin biosynthesis and virginiamycin M1 resistance. (Mol Microbiol. , 2000)
[19778967] Null mutation analysis of an afsA-family gene, barX, that is involved in biosynthesis of the {gamma}-butyrolactone autoregulator in Streptomyces virginiae. (Microbiology. , 2010)

close this sectionSequence

selected fasta
>gamma-butyrolactone biosynthesis enzyme [BarX]
MTSTVPRELVHRAAVAEVFLTGWSRTAENRFALTAQWPRAHSYFTPVNGCYDPLLASETI
RQVGTLLSHAEFGVSFGDQFLMWDLHHSVRPEQAGVGAAPADLELDVICSDIRRRGRRLA
GMRYEVTLYCGGQVIATGGAAFDCTSPAVYQRLRGDRVGATGVRPLPQPLAPASVGRFLT
TDVVLSATERPLEWQLRVDEQHPVLFDHPVDHVPGMVLMESARQAAQAIDPSRPFLPTTM
RSEFSRYAELDRPCWIQAEPLPAADNGDRQVRVTGHQDDTTVFSCLIGTRGAAE
selected fasta
>gamma-butyrolactone biosynthesis enzyme [BarX]
ATGACCAGCACGGTTCCGCGGGAGCTGGTCCACCGGGCGGCGGTCGCCGAAGTGTTTCTG
ACGGGATGGAGCCGGACCGCGGAGAACCGATTCGCCCTGACGGCGCAGTGGCCCAGGGCG
CACAGCTACTTCACCCCGGTGAACGGCTGCTACGACCCGCTGCTGGCCTCCGAAACCATC
CGACAGGTCGGTACCCTTCTCTCCCACGCGGAGTTCGGGGTCTCGTTCGGGGACCAGTTC
CTGATGTGGGACCTTCACCACAGCGTCAGGCCCGAGCAGGCGGGCGTCGGTGCCGCCCCG
GCCGACCTGGAACTGGACGTCATCTGTTCCGACATCCGCCGCCGCGGCCGCCGCCTGGCG
GGCATGCGCTACGAGGTCACCCTCTACTGCGGCGGCCAGGTGATCGCCACCGGCGGCGCC
GCCTTCGACTGCACCAGCCCCGCCGTCTACCAGCGGCTGCGCGGTGACCGGGTCGGTGCC
ACGGGCGTGCGGCCCCTGCCGCAGCCGCTCGCCCCCGCGTCGGTCGGCCGCTTCCTCACC
ACGGACGTCGTCCTGTCCGCCACCGAGCGTCCGCTGGAGTGGCAGCTGCGGGTGGACGAA
CAGCATCCCGTGCTCTTCGACCACCCTGTCGACCACGTTCCCGGCATGGTGCTGATGGAG
TCCGCCCGCCAGGCCGCCCAGGCCATCGACCCGTCCCGGCCGTTCCTGCCGACCACGATG
CGCTCCGAGTTCAGCCGGTACGCGGAGCTCGACAGGCCCTGCTGGATACAGGCGGAGCCG
CTGCCCGCGGCCGACAACGGCGACCGGCAGGTCCGCGTCACCGGCCACCAGGACGACACC
ACCGTCTTCAGCTGCCTGATCGGGACCCGAGGCGCAGCCGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005509 A-factor biosynthesis hotdog domain (Domain)
 [9-144]  6.29999999999998e-39 PF03756 [175-289]  1.70000000000001e-34 PF03756
PF03756   AfsA
SignalP No significant hit
TMHMM No significant hit