close all open/close all

CDS information : Virg_00340


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction101,940 / 102,638 / + [in whole cluster]
454 / 1,152 / + [in contig]
Location101940..102638 [in whole cluster]
454..1152 [in contig]
TypeCDS
Length699 bp (232 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
putative virginiae butanolide receptor
Product (GenBank)virginiae butanolide receptor
Gene
Gene (GenBank)barA
EC number
Keyword
  • virginiae butanolide
Note
  • This ORF is involved in both virginiamycin M and virginiamycin S biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[9371444] Butyrolactone autoregulator receptor protein (BarA) as a transcriptional regulator in Streptomyces virginiae. (J Bacteriol. , 1997)
[20516594] Crystallization and preliminary crystallographic studies of the butyrolactone autoregulator receptor protein (BarA) from Streptomyces virginiae. (Acta Crystallogr Sect F Struct Biol Cryst Commun. , 2010)

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [virginiae butanolide receptor]
MAVRHERVAVRQERAVRTRQAIVRAAASVFDEYGFEAATVAEILSRASVTKGAMYFHFAS
KEELARGVLAEQTLHVAVPESGSKAQELVDLTMLVAHGMLHDPILRAGTRLALDQGAVDF
SDANPFGEWGDICAQLLAEAQERGEVLPHVNPKKTGDFIVGCFTGLQAVSRVTSDRQDLG
HRISVMWNHVLPSIVPASMLTWIETGEERIGKVAAAAEAAEAAEASEAASDE
selected fasta
>putative TetR family transcriptional regulator [virginiae butanolide receptor]
ATGGCAGTGCGACACGAACGGGTGGCAGTGCGACAGGAACGGGCCGTCCGCACGCGGCAG
GCGATCGTGCGGGCAGCCGCCTCGGTCTTCGACGAGTACGGGTTCGAGGCCGCCACAGTG
GCAGAGATCCTCTCGCGGGCCTCGGTCACCAAGGGCGCGATGTACTTCCACTTCGCTTCC
AAGGAAGAGCTGGCCCGCGGCGTGCTGGCCGAGCAGACCCTGCACGTGGCGGTGCCGGAA
TCCGGCTCCAAGGCGCAGGAACTGGTAGACCTCACCATGCTGGTCGCCCACGGCATGCTG
CACGATCCGATCCTGCGGGCGGGCACGCGGCTCGCACTGGACCAGGGGGCGGTGGACTTC
TCCGACGCCAACCCGTTCGGCGAGTGGGGCGACATCTGCGCCCAGCTCCTGGCGGAGGCA
CAGGAACGGGGGGAGGTGCTTCCGCACGTGAACCCGAAAAAGACCGGCGACTTCATCGTC
GGCTGCTTCACCGGGCTCCAGGCGGTCTCCCGGGTCACCTCCGACCGCCAGGACCTCGGC
CACCGGATCTCGGTGATGTGGAACCACGTGCTGCCCAGCATCGTGCCGGCGTCCATGCTG
ACCTGGATCGAAACCGGCGAGGAGCGGATCGGGAAGGTCGCGGCGGCGGCCGAGGCCGCC
GAGGCTGCGGAGGCCTCCGAGGCCGCCTCCGACGAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [22-35]  2.49999811956465e-10 PR00455 [43-66]  2.49999811956465e-10 PR00455
PR00455   HTHTETR
 [22-66]  8.00000000000001e-16 PF00440
PF00440   TetR_N
 [16-76]  PS50977
PS50977   HTH_TETR_2
IPR009057 Homeodomain-like (Domain)
 [11-76]  5.40000570248859e-15 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [82-214]  8.90000829418053e-32 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [17-195]  2.1e-28 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
IPR023772 DNA-binding HTH domain, TetR-type, conserved site (Conserved_site)
 [34-64]  PS01081
PS01081   HTH_TETR_1
SignalP No significant hit
TMHMM No significant hit