close all open/close all

CDS information : Virg_00360


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction105,024 / 106,580 / + [in whole cluster]
285 / 1,841 / + [in contig]
Location105024..106580 [in whole cluster]
285..1841 [in contig]
TypeCDS
Length1,557 bp (518 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productvirginiamycin S resistance transporter
Product (GenBank)VarS
Gene
Gene (GenBank)varS
EC number
Keyword
  • virginiamycin S
Note
Note (GenBank)
  • virginiamycin S resistance gene
Reference
ACC
PmId
[10322037] Identification and in vivo functional analysis of a virginiamycin S resistance gene (varS) from Streptomyces virginiae. (J Bacteriol. , 1999)
Related Reference
ACC
O52557
NITE
Rifam_00370
PmId
[17351715] RifP; a membrane protein involved in rifamycin export in Amycolatopsis mediterranei. (Biotechnol Lett. , 2007)

close this sectionSequence

selected fasta
>virginiamycin S resistance transporter [VarS]
MQDTQITAAPVPARNPRRWVILGVICLAQLVVLLDNTVLNLAIPALTEDLGASTTDIQWM
INAYALVQSGLLLTAGSLSDRYGRKKALITGLVAFGLCSTAAAFSASSGQLIAARAGMGI
GGALLMTTTLAVIMQVFDGEELPKAIGMWGAVSSLGFAGGPLVGGVLLAHFWWGSIFLIN
IPVALIGGLAVAKLVPESKNPLGKRPDLVGAVLSTVGMVGVVFAIISGPEHGWTSVSVLV
SALVGLASLTAFVRWELHVPAPMLDMSFFRNRRFNGAVAGGILVAFGMAGSLFLLTQHLQ
LVLNYSPLEAGLRMAPLALTIVGLNLAGVGAKVLPKLGAAGTITSGMTLLAGGLAAVATV
GGSLGYSGMLVGLVLMGSGIALAMRPEWANAIMGSIPPEKAGVGAGVQGTITEFGGGLGV
AVLGAVLNSRFAALLPATVGGRHGRGSLHEALAADPSEDVQEQVRDAFASGVGTSQLIGA
AAVFAGGLLAGLLLHRAARAEAAAAETSAVPAGDKAAA
selected fasta
>virginiamycin S resistance transporter [VarS]
TTGCAAGACACACAGATCACGGCGGCGCCTGTACCGGCCCGCAACCCCAGGCGCTGGGTG
ATCCTCGGCGTCATCTGCCTCGCCCAACTCGTCGTCCTCCTGGACAACACGGTCCTGAAC
CTCGCGATCCCCGCGCTCACCGAGGACCTGGGCGCGAGCACGACGGACATCCAGTGGATG
ATCAACGCCTATGCGTTGGTCCAGTCCGGCCTGCTGCTCACCGCCGGAAGCCTCAGCGAC
CGGTACGGCCGCAAGAAGGCGCTGATCACGGGTCTGGTCGCATTCGGCCTGTGCTCGACG
GCCGCGGCCTTCAGCGCGTCGTCCGGCCAGCTGATCGCCGCCCGTGCGGGCATGGGCATC
GGCGGCGCCCTGCTCATGACCACCACCCTCGCGGTGATCATGCAGGTGTTCGACGGCGAG
GAACTGCCGAAGGCGATCGGTATGTGGGGTGCCGTCAGCTCGCTCGGCTTCGCCGGCGGC
CCCCTGGTGGGCGGCGTTCTGCTGGCCCACTTCTGGTGGGGCTCGATCTTCCTGATCAAC
ATCCCGGTGGCGCTGATCGGCGGGCTGGCCGTCGCCAAGCTCGTCCCGGAGAGCAAGAAC
CCGCTGGGCAAGCGCCCGGACCTGGTCGGCGCCGTACTTTCCACGGTCGGCATGGTCGGC
GTGGTCTTCGCGATCATCTCCGGCCCTGAGCACGGCTGGACGTCCGTCAGCGTGCTGGTA
TCGGCCCTGGTCGGCCTGGCAAGCCTCACCGCCTTCGTCCGCTGGGAGTTGCACGTCCCG
GCGCCGATGCTCGACATGAGCTTCTTCCGCAACCGGCGCTTCAACGGCGCCGTGGCCGGC
GGCATCCTCGTCGCGTTCGGCATGGCGGGCTCGCTGTTCCTGCTCACGCAGCACCTGCAG
CTCGTCCTGAACTACAGCCCGTTGGAAGCCGGCCTGCGCATGGCTCCGCTCGCCTTGACC
ATCGTCGGACTCAACCTGGCGGGTGTCGGCGCGAAGGTGCTGCCGAAGCTCGGTGCCGCC
GGGACCATCACCTCCGGCATGACCCTGCTCGCCGGCGGGCTCGCGGCCGTGGCCACCGTC
GGCGGCAGCCTCGGCTACAGCGGCATGCTGGTCGGCCTGGTGCTCATGGGCTCCGGCATC
GCCCTGGCGATGCGGCCGGAATGGGCCAACGCCATCATGGGCTCCATCCCGCCGGAGAAG
GCCGGTGTAGGAGCGGGCGTCCAGGGAACGATCACCGAATTCGGCGGCGGCCTCGGCGTC
GCGGTCCTCGGTGCCGTGCTGAACTCCCGCTTCGCGGCGCTGCTCCCGGCCACCGTGGGG
GGCCGGCACGGCCGGGGTTCGCTGCACGAGGCGCTCGCCGCCGACCCCTCAGAGGACGTG
CAGGAACAGGTCCGGGACGCGTTCGCTTCCGGGGTCGGCACCAGCCAGCTGATCGGCGCC
GCGGCAGTGTTCGCGGGCGGCCTGCTGGCCGGCCTGCTGCTCCACCGCGCGGCGCGTGCC
GAGGCCGCCGCGGCGGAGACCTCCGCGGTCCCCGCCGGGGACAAGGCTGCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001411 Tetracycline resistance protein TetB/drug resistance transporter (Family)
 [24-48]  1.89999859865864e-10 PR01036 [115-135]  1.89999859865864e-10 PR01036 [145-169]  1.89999859865864e-10 PR01036 [210-228]  1.89999859865864e-10 PR01036 [410-429]  1.89999859865864e-10 PR01036
PR01036   TCRTETB
IPR011701 Major facilitator superfamily (Family)
 [25-419]  2.70000000000002e-51 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-506]  1.09999184471405e-67 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [21-499]  PS50850
PS50850   MFS
SignalP
 [1-34]  0.438 Signal
Eukaryota   
TMHMM
 [20-42]  Transmembrane (i-o) [57-79]  Transmembrane (o-i) [88-107]  Transmembrane (i-o) [111-133]  Transmembrane (o-i) [146-168]  Transmembrane (i-o) [173-195]  Transmembrane (o-i) [208-227]  Transmembrane (i-o) [231-253]  Transmembrane (o-i) [274-296]  Transmembrane (i-o) [311-330]  Transmembrane (o-i) [337-359]  Transmembrane (i-o) [364-383]  Transmembrane (o-i) [404-426]  Transmembrane (i-o) [472-494]  Transmembrane (o-i)
Transmembrane 14