close all open/close all

CDS information : Virg_00370


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction106,735 / 107,478 / + [in whole cluster]
111 / 854 / + [in contig]
Location106735..107478 [in whole cluster]
111..854 [in contig]
TypeCDS
Length744 bp (247 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductTetR family transcriptional regulator
Product (GenBank)VarR
Gene
Gene (GenBank)varR
EC number
Keyword
  • virginiamycin S
Note
Note (GenBank)
Reference
ACC
PmId
[11222601] Identification of the varR gene as a transcriptional regulator of virginiamycin S resistance in Streptomyces virginiae. (J Bacteriol. , 2001)
Related Reference
ACC
Q9F0Y2
PmId
[11050092] A transcriptional regulator of a pristinamycin resistance gene in Streptomyces coelicolor. (J Biol Chem. , 2001)

close this sectionSequence

selected fasta
>TetR family transcriptional regulator [VarR]
MAAKRASQPRSSVWLTPEPTTRGRRGPERGSGAGSLDRERIVAAAVRLLDEQGDAKFTMR
VLATELGVTPMSVYWYIANKDDLMELALDAVAAEIKLPDPAAGLDWREDLRALALSWRRT
MVSHPWAIRSYAEYLNIGPHSMRFSACAQAVVARSPLPEAERPAALSAVFQYVYGFTSME
SRWLEYGKEVGRTADEFLEEVAGSIAQAPEIEAGGGLMERRAGRSLDEMRDSDFDRALDW
LIAGMCD
selected fasta
>TetR family transcriptional regulator [VarR]
GTGGCCGCCAAGCGCGCCTCGCAACCGAGAAGCAGCGTGTGGCTCACTCCGGAGCCGACG
ACCCGCGGCCGCCGGGGTCCCGAACGCGGTTCGGGAGCGGGCAGCCTGGACCGGGAAAGG
ATCGTCGCCGCCGCGGTGCGACTGCTCGACGAACAGGGCGACGCGAAGTTCACGATGCGC
GTGCTGGCCACGGAACTGGGGGTCACCCCCATGTCGGTCTACTGGTACATCGCGAACAAG
GACGACCTGATGGAGCTGGCCCTCGACGCCGTGGCGGCGGAGATAAAGCTCCCCGACCCG
GCGGCCGGCCTGGACTGGCGGGAGGACCTGCGTGCGCTGGCGCTCTCCTGGCGGCGCACC
ATGGTCTCCCACCCGTGGGCCATCCGCTCGTACGCCGAGTACCTCAACATCGGCCCGCAC
AGCATGCGGTTCTCCGCCTGCGCCCAGGCGGTCGTCGCCCGGTCGCCGCTGCCCGAGGCC
GAACGACCCGCCGCGCTGTCGGCCGTGTTCCAGTACGTGTACGGCTTCACCTCGATGGAG
AGCCGCTGGCTGGAGTACGGCAAGGAAGTGGGCCGTACGGCCGACGAGTTCCTGGAGGAG
GTCGCCGGCAGCATCGCGCAGGCCCCCGAGATCGAGGCCGGCGGCGGACTGATGGAACGC
CGCGCCGGACGCAGCCTCGACGAGATGCGCGACAGCGACTTCGACCGCGCCCTCGACTGG
CTGATCGCCGGCATGTGTGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [35-95]  PS50977
PS50977   HTH_TETR_2
 [41-85]  2e-11 PF00440
PF00440   TetR_N
 [41-54]  2.59999946718995e-06 PR00455 [62-85]  2.59999946718995e-06 PR00455
PR00455   HTHTETR
IPR004111 Tetracycline transcriptional regulator, TetR, C-terminal (Domain)
 [100-245]  2.2e-11 PF02909
PF02909   TetR_C
IPR009057 Homeodomain-like (Domain)
 [28-91]  1.5e-21 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
 [36-95]  9.40001006865064e-13 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [104-245]  1.50000306971104e-24 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [92-245]  6.3e-24 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP
 [1-23]  0.134 Signal
Eukaryota   
TMHMM No significant hit