close all open/close all

CDS information : Virg_00380


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction109,634 / 108,375 / - [in whole cluster]
1,870 / 611 / - [in contig]
Locationcomplement(108375..109634) [in whole cluster]
complement(611..1870) [in contig]
TypeCDS
Length1,260 bp (419 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
ProductL-lysine C-2 aminotransferase
Product (GenBank)L-lysin 2-aminotransferase
Gene
Gene (GenBank)visA
EC number2.6.1.-
Keyword
  • virginiamycin S
  • 3-hydroxypicolinic acid
Note
Note (GenBank)
  • VisA
Reference
ACC
PmId
[11943483] Characterization of virginiamycin S biosynthetic genes from Streptomyces virginiae. (Gene. , 2002)
[12169606] Identification by heterologous expression and gene disruption of VisA as L-lysine 2-aminotransferase essential for virginiamycin S biosynthesis in Streptomyces virginiae. (J Bacteriol. , 2002)

close this sectionSequence

selected fasta
>L-lysine C-2 aminotransferase [L-lysin 2-aminotransferase]
MTAAQRYLVPFQRRGSIVGQADLAALASVVHSAEPLSAGVWRERFEQRFREVTGARHALS
VTSGTVALELAVRLLDLQPGDEVIATPQTFQATVQPLLDHDVTVRFCDVDPDTLNMDPQV
LDSLITDRTKAILLVHYGGLPADMAAILARARRAGVVVVEDCAHGWGASYQGDSPGALGD
IGCFSFHSTKNITTLGEGGMITLNRADWAERVERLRGNEVDGVFAPVPGFADDEPALLPW
MRFSADVYRRQAVGIRGAGTNATMSEAAAAVGLVQLDALERFTERRRWIAARLDAAVSAF
PRHPPPTHAGGSTHAYHLYTFFVTAGREGARDSCAPLDRRGVEVQLRYFPLHLLPEVAAA
RPRSGRVPQAERVWFDEHLNLPCHPGLTDEQVDHLVESVTAAMHEATALARTGRPLAVR
selected fasta
>L-lysine C-2 aminotransferase [L-lysin 2-aminotransferase]
GTGACGGCGGCGCAGCGCTACCTGGTGCCGTTCCAGCGCCGGGGGAGCATCGTGGGCCAG
GCCGACCTGGCGGCGCTCGCCTCGGTCGTGCACTCGGCGGAGCCGCTGTCGGCGGGGGTG
TGGCGCGAGCGGTTCGAGCAGCGCTTCCGGGAGGTCACCGGGGCCCGCCACGCGCTGTCG
GTGACCAGCGGGACGGTGGCTCTGGAGCTGGCCGTCCGGCTGCTCGACCTGCAGCCCGGC
GACGAGGTGATCGCCACCCCGCAGACGTTCCAGGCGACGGTGCAGCCGTTGCTCGACCAC
GACGTCACCGTGCGGTTCTGCGACGTCGACCCGGACACCCTGAACATGGACCCGCAGGTC
CTGGATTCGCTGATCACCGACCGGACGAAGGCCATCCTGCTGGTGCACTACGGCGGCCTT
CCGGCGGACATGGCGGCCATCCTGGCCCGGGCCCGCCGTGCGGGCGTCGTGGTGGTGGAG
GACTGCGCGCACGGCTGGGGCGCTTCCTACCAGGGGGACAGCCCCGGCGCGCTCGGCGAC
ATCGGGTGCTTCAGCTTCCACTCGACGAAGAACATCACCACGCTCGGCGAGGGGGGCATG
ATCACGCTGAACCGGGCCGACTGGGCCGAGCGGGTCGAGCGGCTGCGGGGCAACGAGGTG
GACGGGGTGTTCGCCCCGGTGCCCGGCTTCGCGGACGACGAGCCCGCGCTGCTGCCGTGG
ATGCGCTTCTCCGCCGACGTCTACCGCCGCCAGGCCGTCGGTATCCGGGGAGCGGGCACC
AACGCCACCATGTCCGAGGCCGCCGCGGCGGTCGGGCTGGTCCAGCTGGATGCGCTGGAG
CGGTTCACCGAGCGCCGTCGGTGGATCGCGGCCCGGCTGGACGCCGCCGTCTCGGCGTTT
CCCCGGCACCCGCCTCCAACGCACGCCGGAGGCAGCACCCACGCCTACCACCTGTACACG
TTCTTCGTCACGGCCGGGCGTGAGGGTGCGCGAGATTCGTGCGCGCCCCTGGACCGCAGG
GGCGTGGAGGTTCAGCTGCGGTACTTCCCGCTGCACCTGCTGCCCGAAGTGGCGGCTGCG
CGGCCACGGTCCGGGCGAGTGCCGCAGGCCGAGCGGGTCTGGTTCGACGAGCACCTGAAC
CTGCCCTGCCACCCGGGGCTCACCGACGAGCAGGTCGACCACCTTGTCGAGTCGGTCACC
GCTGCGATGCACGAGGCCACGGCCCTCGCCAGGACGGGCCGGCCGCTGGCGGTCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [19-399]  8.60000000000005e-95 PF01041
PF01041   DegT_DnrJ_EryC1
 [1-407]  2.2999842048857e-78 PIRSF000390
PIRSF000390   PLP_StrS
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [19-277]  3.10000000000005e-67 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [279-405]  2.5e-21 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [5-406]  3.99998544139406e-86 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP
 [1-38]  0.626 Signal
Eukaryota   
TMHMM No significant hit