close all open/close all

CDS information : Virg_00390


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction111,286 / 109,631 / - [in whole cluster]
3,522 / 1,867 / - [in contig]
Locationcomplement(109631..111286) [in whole cluster]
complement(1867..3522) [in contig]
TypeCDS
Length1,656 bp (551 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase adenylation domain protein
Product (GenBank)3-hydroxypicolinic acid:AMP ligase
Gene
Gene (GenBank)visB
EC number
Keyword
  • virginiamycin S
  • 3-hydroxypicolinic acid
Note
Note (GenBank)
  • VisB
Reference
ACC
PmId
[11943483] Characterization of virginiamycin S biosynthetic genes from Streptomyces virginiae. (Gene. , 2002)
Related Reference
ACC
Q8GA86
PmId
[11112781] The dhb operon of Bacillus subtilis encodes the biosynthetic template for the catecholic siderophore 2,3-dihydroxybenzoate-glycine-threonine trimeric ester bacillibactin. (J Biol Chem. , 2001)
[12221282] Crystal structure of DhbE, an archetype for aryl acid activating domains of modular nonribosomal peptide synthetases. (Proc Natl Acad Sci U S A. , 2002)

close this sectionPKS/NRPS Module

S0
A53..465

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase adenylation domain protein [3-hydroxypicolinic acid:AMP ligase]
MLDGCVPWPPDAAERYREAGYWRGETLGALLRGWAERYGDRVALVGDDGTRVTYRELDMW
CDRLAAGFAGQGVAPRERVLVQLPNTPSFVAVCFALFRLGAVPVFALPSYAVRSCGTWRS
CPVRSRWWIPDEVRGFDHRALVRDLLPELPRVARVFVAGDPGGEEDGLVALAALEQDPVA
LPEPDASDVAFFLLSGGTTALPKMIPRTHDDYAYQTRITAGICELGEDTVYLAVLPVEFN
FPWGCPGIIGVLGVGGRVVFAPDPTPQTCFPLIERERVTMTSVIPTIVHLWLDAAGRTGH
DLSSLDVVQVGSSKLHDEVAARIEPELGVRLQQVFGMAEGLLTFTRYDDPRQVVLTTQGR
PVSPADEIRVVDGDDREVPDGTVGELLTRGPYTLRGYYRAPEHNASAFTADGFYRSGDLV
RRTPTGEIVVEGRVKDVVIRGGDKVSATEVEGHLTAHPGVQQAAVVAKPDRVLGEKICAY
VVADRDGPAPTLPGVRRLLRARGLADFKLPDRLEVVEVFPLTGLNKVDKKVLAARAGLLH
SGGGAGRGDAR
selected fasta
>non-ribosomal peptide synthetase adenylation domain protein [3-hydroxypicolinic acid:AMP ligase]
ATGCTGGATGGATGCGTGCCGTGGCCCCCTGATGCCGCCGAGCGCTACCGCGAGGCCGGG
TACTGGCGCGGTGAGACGCTCGGTGCCCTGCTGCGCGGTTGGGCCGAGAGGTACGGGGAC
CGGGTCGCCCTGGTGGGTGACGACGGCACCCGGGTGACGTACCGCGAACTGGACATGTGG
TGCGACCGGCTGGCCGCCGGTTTTGCCGGGCAGGGTGTGGCGCCGCGCGAGCGCGTGCTG
GTGCAGCTGCCGAACACCCCGTCGTTCGTGGCGGTCTGTTTCGCCCTGTTCCGGCTGGGC
GCGGTGCCGGTTTTCGCGCTGCCGTCGTACGCAGTGCGGAGCTGCGGCACCTGGCGGAGC
TGTCCGGTGCGGTCGCGATGGTGGATCCCGGACGAGGTCAGGGGGTTCGACCACCGTGCG
CTCGTGCGCGACCTGCTGCCGGAGCTCCCGCGCGTGGCCCGGGTCTTCGTGGCGGGCGAT
CCGGGCGGAGAGGAGGACGGCCTGGTCGCGCTGGCGGCCCTGGAGCAGGATCCGGTCGCA
CTGCCCGAGCCGGACGCCTCCGACGTCGCGTTCTTCCTGTTGTCCGGCGGTACGACCGCG
CTGCCGAAGATGATCCCCCGCACCCACGACGACTACGCGTACCAGACCCGGATCACCGCC
GGGATCTGCGAACTCGGCGAGGACACCGTCTACCTGGCGGTGCTGCCGGTGGAGTTCAAC
TTCCCGTGGGGTTGTCCCGGCATCATCGGCGTACTGGGCGTCGGCGGCCGGGTGGTGTTC
GCGCCGGACCCGACCCCGCAGACCTGCTTCCCGCTGATCGAGCGGGAGCGGGTCACCATG
ACCTCGGTCATCCCGACCATCGTGCACCTGTGGCTGGACGCGGCCGGGCGCACCGGCCAC
GACCTGTCCAGCCTGGACGTCGTACAGGTAGGCAGTTCCAAGCTGCACGACGAGGTCGCC
GCCCGGATCGAGCCCGAGCTCGGGGTGCGGCTCCAGCAGGTGTTCGGCATGGCGGAGGGG
CTGCTGACCTTCACCCGCTACGACGACCCGCGGCAGGTCGTCCTGACCACCCAGGGCCGG
CCGGTGTCGCCGGCCGACGAGATCCGGGTGGTGGACGGCGACGACCGCGAGGTGCCGGAC
GGTACGGTCGGCGAGCTGCTGACCCGGGGCCCGTACACGCTGCGCGGCTACTACCGTGCT
CCGGAGCACAACGCCTCGGCATTCACCGCGGACGGGTTCTACCGCAGCGGTGACCTGGTC
CGCAGGACCCCCACCGGTGAGATCGTGGTCGAGGGCCGGGTCAAGGACGTGGTGATCCGC
GGCGGCGACAAGGTGTCCGCGACGGAGGTCGAGGGCCATCTGACGGCGCACCCGGGCGTG
CAGCAGGCCGCGGTGGTCGCGAAGCCCGACCGCGTACTGGGCGAAAAGATCTGCGCCTAC
GTGGTTGCCGACCGGGACGGGCCGGCGCCCACTCTGCCGGGAGTGCGCCGGCTCCTGCGC
GCCCGCGGCCTGGCCGACTTCAAACTGCCGGACCGACTGGAGGTGGTGGAGGTCTTCCCG
CTGACCGGTCTGAACAAGGTGGACAAGAAGGTCCTCGCGGCCCGGGCCGGGCTCCTGCAC
AGTGGTGGCGGTGCGGGCCGAGGAGATGCGCGGTGA
[0] A53..465
[0] A157..1395

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [53-465]  5.90000000000008e-81 PF00501
PF00501   AMP-binding
SignalP
 [1-35]  0.063 Signal
Bacteria, Gram-negative   
TMHMM No significant hit