close all open/close all

CDS information : Virg_00400


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction111,523 / 112,410 / + [in whole cluster]
3,759 / 4,646 / + [in contig]
Location111523..112410 [in whole cluster]
3759..4646 [in contig]
TypeCDS
Length888 bp (295 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative lysine cyclodeaminase
Product (GenBank)lysine cyclodeaminase
Gene
Gene (GenBank)visC
EC number
Keyword
  • virginiamycin S
  • L-pipecolate
Note
Note (GenBank)
  • VisC
Reference
ACC
PmId
[11943483] Characterization of virginiamycin S biosynthetic genes from Streptomyces virginiae. (Gene. , 2002)
Related Reference
ACC
Q54304
NITE
Rapam_00190
PmId
[9473033] Mutational biosynthesis of novel rapamycins by a strain of Streptomyces hygroscopicus NRRL 5491 disrupted in rapL, encoding a putative lysine cyclodeaminase. (J Bacteriol. , 1998)
[16536560] Biosynthesis of pipecolic acid by RapL, a lysine cyclodeaminase encoded in the rapamycin gene cluster. (J Am Chem Soc. , 2006)

close this sectionSequence

selected fasta
>putative lysine cyclodeaminase [lysine cyclodeaminase]
METWVLSERDVTRAVESVGRDALMDRVIDRLTEGLAEVGRGAARSPAARGFNREKPVPGI
WEWMPHRESGDSITLKAVGYSPANPGRFGLPTIIGTVARFDDTTGSLTALIDGVLLTAIR
TGAASAFASRLLAAPDSRVVGLIGSGAQSVTQLHALTRVFPVERVLTWDADPSHAASLAD
RVAFLGLDVQVAEPHRIAAEADIICTATTVPVGGGPVLPADAVFRPHLHINAIGRDLVGK
TELPLDLLRRAHVSPDHPEQARHEGECQQLEPHEIGLSLGELCADPRPPTLCAAD
selected fasta
>putative lysine cyclodeaminase [lysine cyclodeaminase]
ATGGAGACCTGGGTCCTGAGCGAGCGCGACGTGACACGGGCTGTGGAGAGCGTGGGCCGC
GACGCCCTGATGGACCGCGTCATCGACCGCCTCACCGAGGGCCTCGCCGAAGTCGGCCGG
GGCGCCGCGCGCTCTCCCGCAGCGCGCGGATTCAACCGGGAGAAACCGGTCCCGGGTATC
TGGGAGTGGATGCCGCACCGCGAAAGCGGCGACAGCATCACCCTGAAGGCCGTCGGCTAC
AGCCCCGCCAACCCGGGGCGGTTCGGCCTGCCGACCATCATCGGCACGGTCGCCCGCTTC
GACGACACGACCGGCTCGCTGACCGCGCTGATCGACGGCGTGCTGCTCACCGCGATCCGT
ACGGGCGCGGCGAGCGCGTTCGCCAGCCGGCTGCTGGCCGCACCGGACAGCCGCGTGGTC
GGACTCATAGGGTCCGGCGCCCAGTCGGTGACCCAGCTCCACGCCCTCACCCGCGTCTTC
CCTGTCGAGCGGGTGCTCACCTGGGACGCCGACCCGTCGCACGCTGCGAGCCTCGCCGAC
CGGGTGGCGTTCCTCGGCCTCGACGTGCAGGTCGCCGAACCGCACCGGATCGCGGCCGAG
GCCGACATCATCTGCACCGCCACCACCGTCCCGGTCGGCGGCGGGCCCGTCCTGCCGGCC
GATGCCGTGTTCCGCCCCCACCTGCACATCAACGCCATCGGGCGCGACCTGGTCGGCAAG
ACCGAGCTGCCGCTCGACCTGCTGCGGCGGGCGCACGTGAGCCCCGACCACCCCGAGCAG
GCCCGCCACGAGGGCGAGTGCCAGCAGTTGGAGCCGCACGAGATCGGGCTCAGCCTCGGA
GAGCTCTGCGCCGATCCGCGGCCGCCGACGCTCTGCGCGGCCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003462 Ornithine cyclodeaminase/mu-crystallin (Family)
 [1-295]  2.10000267834031e-21 PIRSF001439
PIRSF001439   CryM
 [10-284]  6.60000000000002e-70 PF02423
PF02423   OCD_Mu_crystall
IPR016040 NAD(P)-binding domain (Domain)
 [135-288]  5.49999999999995e-40 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit