close all open/close all
Virg_00400 Virg_00400   last last

CDS information : Virg_00410


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction112,758 / 113,966 / + [in whole cluster]
4,994 / 6,202 / + [in contig]
Location112758..113966 [in whole cluster]
4994..6202 [in contig]
TypeCDS
Length1,209 bp (402 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)cytochrome P450 monooxygenase
Gene
Gene (GenBank)visD
EC number
Keyword
  • virginiamycin S
Note
Note (GenBank)
  • VisD
Reference
ACC
PmId
[11943483] Characterization of virginiamycin S biosynthetic genes from Streptomyces virginiae. (Gene. , 2002)
Related Reference
ACC
P48635
PmId
[8416893] Identification of a Saccharopolyspora erythraea gene required for the final hydroxylation step in erythromycin biosynthesis. (J Bacteriol. , 1993)
[7849045] Overproduction and characterization of the erythromycin C-12 hydroxylase, EryK. (Biochemistry. , 1995)

close this sectionSequence

selected fasta
>putative cytochrome P450 [cytochrome P450 monooxygenase]
MAQQTPPAPPSMADGGKAMLAWLRTMRDEHPVHEDQYGVFHVYRHSDVLAVTSDPAVFSS
DLSRLRPDSSALSEEILSVIDPPLHRKLRSLVSQAFTLRTVADLEPRVTELAGRLLEKVE
GSEFDLVGDFAYPLPVIVIAELLGVPAEDRELFRGWSDRMLSMQVDDPLEIQFGDEAGED
YERLVKEPLKEMHAYLQRHVDARRETPGDDLLSRLVTAEIAGERLTDRQIVEFGALLLMA
GHVSTSMLLGNTVLCLEENPETAAALRADRALISGVIEEVLRMRPPITVAARVTTGEVVV
GGVTIPKDRMVMASLLSANHDERHIQDPEVFDPRRSPNPQLAFGHGIHYCLGGPLARLEG
RVALEMLLDRFEDIRVTPGAPYDFHREGLFVPARSPLTVRRG
selected fasta
>putative cytochrome P450 [cytochrome P450 monooxygenase]
ATGGCCCAGCAGACCCCTCCCGCACCACCGTCCATGGCGGACGGCGGCAAGGCGATGCTC
GCCTGGCTGCGGACGATGCGTGACGAACACCCCGTCCACGAGGACCAGTACGGTGTGTTC
CACGTCTACCGCCACAGCGACGTCCTGGCGGTGACCTCCGACCCCGCCGTCTTCTCCTCC
GACCTGAGCCGGCTGCGTCCGGACTCCAGTGCGCTCAGTGAGGAGATCCTCTCCGTCATC
GACCCGCCGCTCCACCGCAAGCTGCGCAGCCTCGTCAGCCAGGCGTTCACCCTGCGCACC
GTGGCCGACCTGGAGCCTCGTGTCACCGAACTCGCCGGCCGGCTGCTGGAGAAGGTCGAG
GGCAGCGAGTTCGACCTGGTCGGTGACTTCGCCTACCCGCTCCCCGTGATCGTGATCGCC
GAGCTGCTGGGCGTCCCGGCCGAGGACCGCGAGCTGTTCCGCGGTTGGTCCGACCGGATG
CTCTCGATGCAGGTCGACGACCCCCTCGAGATTCAGTTCGGGGACGAGGCGGGCGAGGAC
TACGAGCGGCTGGTCAAGGAGCCGCTCAAGGAGATGCACGCCTACCTCCAGCGGCACGTC
GACGCCCGCCGCGAAACGCCGGGCGACGACCTGCTGTCCCGACTGGTGACGGCGGAGATC
GCCGGCGAGAGGCTGACGGACCGCCAGATCGTCGAGTTCGGCGCGCTGCTGCTGATGGCC
GGGCACGTTTCCACGTCGATGCTGCTCGGCAACACGGTGCTCTGCCTGGAGGAGAACCCC
GAGACCGCCGCCGCGCTGCGGGCCGACCGCGCCCTGATCTCGGGCGTCATCGAGGAGGTC
CTGCGGATGCGGCCCCCGATCACGGTCGCGGCCCGGGTCACCACCGGGGAGGTCGTCGTC
GGCGGGGTGACCATCCCGAAGGATCGGATGGTCATGGCGTCGCTGCTCTCGGCCAATCAC
GACGAGCGGCACATCCAGGACCCGGAGGTCTTCGACCCCAGGCGCAGTCCCAACCCTCAG
CTGGCCTTCGGCCACGGCATCCACTACTGCCTCGGCGGTCCGCTGGCCCGCCTGGAGGGC
AGGGTCGCCCTGGAGATGCTGCTGGACCGGTTCGAGGACATCAGGGTCACTCCGGGCGCG
CCGTACGACTTCCACCGCGAGGGGCTGTTCGTGCCCGCTCGCTCCCCCCTGACCGTCCGT
CGCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [10-398]  5.09999999999992e-105 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [75-372]  1.9e-29 PF00067
PF00067   p450
 [2-401]  2.19999900980707e-92 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [80-91]  4.10001399699315e-52 PR00359 [125-141]  4.10001399699315e-52 PR00359 [142-157]  4.10001399699315e-52 PR00359 [194-216]  4.10001399699315e-52 PR00359 [275-286]  4.10001399699315e-52 PR00359 [292-319]  4.10001399699315e-52 PR00359 [320-335]  4.10001399699315e-52 PR00359 [341-350]  4.10001399699315e-52 PR00359 [350-361]  4.10001399699315e-52 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [343-352]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit
Virg_00400 Virg_00400   last last